Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_037569935.1 BS73_RS04585 SDR family oxidoreductase
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >NCBI__GCF_000744815.1:WP_037569935.1 Length = 258 Score = 146 bits (369), Expect = 4e-40 Identities = 91/244 (37%), Positives = 130/244 (53%), Gaps = 7/244 (2%) Query: 25 LLTGAAQGIGEAIVAAFASQQARLVISDIQAQKVEAVAAHWRERGADVHALQADVSKQQD 84 L+TG A GIG A+ A A+ A + I+D + AA G AL+ DV+ + Sbjct: 19 LVTGGASGIGLAVAARLAAGGAAVAIADYNEEAAHKAAADLAAGGVRATALRMDVTDPES 78 Query: 85 LQAMARRAVELHGRIDVLVNCAGVNVFRDPL-EMTEEDWRRCFAIDLDGAWYGCKAVLPQ 143 ++A A E G + + VN AG++ P E E WRR A +LDG +Y + LP Sbjct: 79 VRAGTEAAAEALGGLHLAVNNAGISGEAAPTGEYPVEVWRRVLATNLDGVFYSLRYELPL 138 Query: 144 MIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAPGYI 203 ++ G G+++N+AS+ ++ G Y AKHG++GLT+ +EYA +GVR+NA PG+I Sbjct: 139 ILAAGGGAVVNMASILGTNGFAGAPAYVAAKHGVVGLTKTAALEYAGQGVRINAAGPGFI 198 Query: 204 ETQLNVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVFLASDEAPFINASCITID 263 +T L +G A + LHP R+G+ EVA FL S A FIN S ID Sbjct: 199 DTPL----LSGM--DRAAHDALVTLHPQGRLGRAEEVAELTAFLLSHRASFINGSYHLID 252 Query: 264 GGRS 267 GG S Sbjct: 253 GGYS 256 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 258 Length adjustment: 25 Effective length of query: 247 Effective length of database: 233 Effective search space: 57551 Effective search space used: 57551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory