Align Tagatose-6-phosphate kinase; EC 2.7.1.144; Phosphotagatokinase (uncharacterized)
to candidate WP_037571123.1 BS73_RS09750 1-phosphofructokinase family hexose kinase
Query= curated2:Q833W9 (313 letters) >NCBI__GCF_000744815.1:WP_037571123.1 Length = 305 Score = 157 bits (397), Expect = 3e-43 Identities = 100/297 (33%), Positives = 152/297 (51%), Gaps = 10/297 (3%) Query: 1 MIVTVTMNPSIDISYLLDHLKLDTVNRTSQVTKTPGGKGLNVTRVIHDLGGDVIATGVLG 60 MI+TVT N ++D+SY L L+ NR V + GGKG+NV RV+H LG V+A G+ G Sbjct: 1 MILTVTPNAALDVSYHLPELRPGEENRVRSVRERAGGKGVNVARVLHALGEPVLAAGLAG 60 Query: 61 GFHGAFIANELKKANIPQAFTSIKEETRDSIAIL--HEGNQTEILEAGPTVSPEEISNFL 118 G G I +EL + +P+A T + E+R ++A++ G T + E G V+ E + F Sbjct: 61 GLTGRRIRDELAASGVPEALTEVTAESRRTVAVVATERGEATGLWEPGAEVAAGEWTRFR 120 Query: 119 ENFDQLIKQAEIVTISGSLAKGLPSDFYQELVQKAHAQEVKVLLDTSGDSLRQVLQGPWK 178 + +L+ + V + GSL G P D Y +L A A V LLD G++L L Sbjct: 121 AAYRELLARTRAVALCGSLPPGAPGDAYAQLGADARAAGVPWLLDADGEALAAGLAA--G 178 Query: 179 PYLIKPNLEELEGLLGQDFSENPLAAVQTALTKPMFAGIEWIVISLGKDGAIAKHHDQFY 238 P L+KPN EL + G + LA + L G +V+SLG +G +A + + Sbjct: 179 PDLVKPNAAELRRVAGD--GDGELAGAERLLA----LGARAVVVSLGAEGMLAVTPEGAW 232 Query: 239 RVKIPTIQAKNPVGSGDATIAGLAYGLAKDAPAAELLKWGMAAGMANAQERMTGHVD 295 R P + N G+GDA +A L+ G+A+ P + ++ +A A + G D Sbjct: 233 RAAPPRVVHGNATGAGDAAVAALSRGVARGLPWQDRVRDAVALSAAAVASPVAGGYD 289 Lambda K H 0.315 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 305 Length adjustment: 27 Effective length of query: 286 Effective length of database: 278 Effective search space: 79508 Effective search space used: 79508 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory