Align phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (EC 5.4.2.2) (characterized)
to candidate WP_037575791.1 BS73_RS24040 phosphomannomutase/phosphoglucomutase
Query= BRENDA::Q8PGN7 (450 letters) >NCBI__GCF_000744815.1:WP_037575791.1 Length = 467 Score = 301 bits (772), Expect = 2e-86 Identities = 194/463 (41%), Positives = 257/463 (55%), Gaps = 27/463 (5%) Query: 9 KAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAGLRASGR 68 KAYDIRG VPD+ + DLAR G A +V+GHD+R +SP L A + G G Sbjct: 9 KAYDIRGVVPDQWDADLARAFGAAFVEVTGATSIVVGHDMRPSSPGLSGAFAEGAAGYGA 68 Query: 69 DVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDTGLFAIR 128 DV+ IGLC T+++YF + L G M TASHNP YNG+KL R ARP+ +TGL IR Sbjct: 69 DVVLIGLCSTDQLYFASGKLDLPGA-MFTASHNPARYNGIKLCRSGARPVGQETGLAEIR 127 Query: 129 DTV-----------AADTAAPGEPTASEQSRTDKT---AYLEHLLSYVDRSTLKPLKLVV 174 V A A P P A + T + AY +HL S VD S +PLK+VV Sbjct: 128 ALVESWTVTDPGTGARTVAFPARPGAEPGAVTGQDLLQAYADHLRSLVDLSASRPLKVVV 187 Query: 175 NAGNGGAGLIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADF 234 +AGNG AG V + LP + ++ E DG FPN NPL P N V++ GAD Sbjct: 188 DAGNGMAGHTVPTVLAGLPLDIDPLYFELDGTFPNHEANPLDPANLVDLQHRVRETGADI 247 Query: 235 GIAWDGDFDRCFFFDHTGRFIEGYYLVGLLA-----QAILAKQPGGKVVHDPRLTWNTVE 289 G+A+DGD DRCF D G + + L+A +A A + G V+H+ +T TV Sbjct: 248 GLAFDGDADRCFVVDERGEPVSPSAVTALVAVRELERAKAAGETGLTVIHN-LITSRTVP 306 Query: 290 QVEEA-GGIPVLCKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWL-LIAE 347 V A G PV + GH++IK++M A++GGE SAH+YFR+F AD+GM+ L ++AE Sbjct: 307 DVVRAQGATPVRTRVGHSYIKQEMARTGAIFGGEHSAHYYFRDFWRADTGMLAALHVLAE 366 Query: 348 LVSQSGRSLADLVEARMQKFPCSGEINFKVADAKASVARVMEHYASL-SPELDYTDGISA 406 L +Q + L+ LV A ++P SGEIN VAD A V +A +D DG++ Sbjct: 367 LGAQP-KPLSALV-AEYDRYPASGEINSTVADQAERTAAVRAAFAGRPGASVDELDGLTV 424 Query: 407 DFGQWRFNLRSSNTEPLLRLNVETRGDAALLETRTQEISNLLR 449 W FNLR SNTEPLLRLNVE + + R E+ L+R Sbjct: 425 STASWWFNLRPSNTEPLLRLNVEADDEETMARIR-DEVLGLVR 466 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 554 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 467 Length adjustment: 33 Effective length of query: 417 Effective length of database: 434 Effective search space: 180978 Effective search space used: 180978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory