Align 5-dehydro-4-deoxyglucarate dehydratase (EC 4.2.1.41) (characterized)
to candidate WP_037580350.1 BS73_RS20185 5-dehydro-4-deoxyglucarate dehydratase
Query= reanno::BFirm:BPHYT_RS24155 (305 letters) >NCBI__GCF_000744815.1:WP_037580350.1 Length = 318 Score = 216 bits (551), Expect = 4e-61 Identities = 130/292 (44%), Positives = 172/292 (58%), Gaps = 9/292 (3%) Query: 16 LSFPVTDFDEQGDFRADTYAERLEWLAPYGASALFVAGGTGEFFSLTHNDYSNVVKTATE 75 LSFP+T FDE AD AE + G+ A+FVA GTGEF +L+ ++Y VV+ A Sbjct: 11 LSFPLTPFDEDDRVAADVLAEHVGEQIAAGSRAVFVACGTGEFSALSRSEYREVVRIAVR 70 Query: 76 VCKGKVPILAGAGGPTRVAIAYAQEAERHGANGILLMPHYLTEACQEGIAAHAEEVCKSV 135 V G+VP+ AGAGG A Y +A GA+G+LL+P YL + EG+ AH + Sbjct: 71 VAAGRVPVFAGAGGGAATAREYLADAAECGADGVLLLPPYLVSSTPEGVLAHIRYAVRDT 130 Query: 136 PNMGVIIYNRANSKLNADMLEGLAERCPNLIGFKDGVGEIENM---VSIRRRLGDR---- 188 + VI+Y RAN+ L+ D L + P ++G KDG+G IE M V+ R G Sbjct: 131 -RLPVIVYQRANAVLDPDTALQLLD-LPQVVGLKDGIGNIEQMNRIVTAVRTSGHPRAAG 188 Query: 189 FSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHATVGKLIDEFF 248 F +L GLPTAE+ AAY+A+GV YSSAV F P + F RA+ A D V L+ EF Sbjct: 189 FHFLNGLPTAELSTAAYRAIGVTSYSSAVHAFAPDLSHAFARALDAGDQDLVDDLMAEFL 248 Query: 249 LPYLAIRNRRAGYAVSIVKAGAKLVGHSAGPVRAPLTDLTEEEMGKLDALIK 300 LP +R++ GYAVS+VKAGA+L G +AGPVR PL + TE L ALI+ Sbjct: 249 LPLGELRDKVPGYAVSLVKAGARLGGLAAGPVRPPLVEPTEAHTETLAALIE 300 Lambda K H 0.319 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 318 Length adjustment: 27 Effective length of query: 278 Effective length of database: 291 Effective search space: 80898 Effective search space used: 80898 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory