Align 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized)
to candidate WP_037582103.1 BS73_RS31540 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= metacyc::MONOMER-4906 (205 letters) >NCBI__GCF_000744815.1:WP_037582103.1 Length = 204 Score = 134 bits (336), Expect = 2e-36 Identities = 69/193 (35%), Positives = 114/193 (59%), Gaps = 7/193 (3%) Query: 11 KIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELSFLK-EKGAIIGAGT 69 +++ V+RA + +A A+ EGG+ +E+TFT PD ++ + + E G IGAGT Sbjct: 8 RVLTVVRAPRIPDAAALCRALAEGGIRTVELTFTTPDLTGHLRAAAAVAAETGCRIGAGT 67 Query: 70 VTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILK 129 V + AV++GAEF+V+P L E++ +E+GV + G TPTE++ A+ LG +K Sbjct: 68 VLTAGDAAAAVDAGAEFLVTPGLRPEVAAVGRERGVPVVMGAFTPTEVLTALDLGAAAVK 127 Query: 130 LFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGS------ALVK 183 +FP +GP++ K ++GP P+V+ +P+GGVN N E+ G +AV G+ A+ Sbjct: 128 IFPAHALGPRYFKDLRGPLPDVRLLPSGGVNAGNAGEFLAQGAIAVSAGTDAVPPQAVAS 187 Query: 184 GTPDEVREKAKAF 196 G E+ +A+ F Sbjct: 188 GDWPEITRRAREF 200 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 204 Length adjustment: 21 Effective length of query: 184 Effective length of database: 183 Effective search space: 33672 Effective search space used: 33672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory