Align Aquaporin-3, Aqp-3 of 271 aas (characterized)
to candidate WP_037576110.1 BS73_RS24920 MIP family channel protein
Query= TCDB::729057658 (271 letters) >NCBI__GCF_000744815.1:WP_037576110.1 Length = 240 Score = 101 bits (252), Expect = 1e-26 Identities = 72/227 (31%), Positives = 112/227 (49%), Gaps = 28/227 (12%) Query: 24 RCFLAEFLGTALICYVSV------IYQHGPVPAAFVVGLTLAWIAWVFGPVSGAHVNPVV 77 R EFLGTAL+ + +V G A G L + + GPVSG HVNP V Sbjct: 6 RAIFCEFLGTALLVFFAVGSAVISAQFIGTFGIALAFGFVLMALVYAIGPVSGCHVNPAV 65 Query: 78 SLMMLLVRKVWFLDALIYIVAQLLGSMAGS---WIGTLAVPAVDAGNTLGMT----TISA 130 ++ L+ R++ + A Y VAQ +G +AG+ ++ VP + + G S Sbjct: 66 TMGALVARRIDLITAACYWVAQFVGGIAGAALLYLLAHQVPGLTTHDAFGSNGYGDRSSV 125 Query: 131 NITVGQAIGLEIVATALLLLVILSAVDELRPKPWNVGNVTIFPF---IFGATLALLASLL 187 +++ G A E+V T LL+ V+LS V+++ F G +L ++ + Sbjct: 126 HLSQGGAFLAEVVLTFLLVWVVLSVTH----------RVSLYKFAGLAIGVSLTVIHLVG 175 Query: 188 GDLTGASMNPARSFGPAVV--NNNFTDLWVYIVGPFIGALLATVLYE 232 LTG S+NPARS GPA+ + LW++IV P IG ++A ++ E Sbjct: 176 IPLTGTSVNPARSLGPAIFAGGGALSQLWLFIVAPLIGGVIAALVAE 222 Lambda K H 0.326 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 240 Length adjustment: 24 Effective length of query: 247 Effective length of database: 216 Effective search space: 53352 Effective search space used: 53352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory