Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_037572577.1 BS73_RS14720 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000744815.1:WP_037572577.1 Length = 528 Score = 169 bits (427), Expect = 2e-46 Identities = 100/270 (37%), Positives = 150/270 (55%), Gaps = 5/270 (1%) Query: 46 IGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFS 105 I S+ K+ + A LK ++ VG D DV T+ G+++ N P + A+ Sbjct: 48 IRSATKMDAEAIAAAQNLKVIARAGVGLDNVDVQAATKAGVMVVNAPTSNIVTAAELACG 107 Query: 106 LILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFN 165 L++++AR + +K G W+ S GV++ KTLG+VGLGRIG VA+R + F Sbjct: 108 LLISTARHIPAATAALKQGEWKRS---KYTGVELAEKTLGVVGLGRIGVLVAQRMS-AFG 163 Query: 166 MKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKS 225 MKV+ + G + + L ELL +DF+ + +P TPET LIG L +K + Sbjct: 164 MKVVAYDPYIQAARAAQMGVKLLSLDELLEVSDFITVHLPKTPETLGLIGDEALHKVKPT 223 Query: 226 AILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSA 285 ++NA+RG VDE ALI AL++G + GAGLDV+ +EP +DSPL NVV PH+G++ Sbjct: 224 VRIVNAARGGIVDEGALISALKDGRVAGAGLDVYSSEPC-TDSPLFGFDNVVCTPHLGAS 282 Query: 286 THETRHAMARNAAENLVAALDGTLTSNIVN 315 T E + A+++ AL G L + VN Sbjct: 283 TDEAQEKAGIAVAKSVRLALAGELVPDAVN 312 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 528 Length adjustment: 31 Effective length of query: 290 Effective length of database: 497 Effective search space: 144130 Effective search space used: 144130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory