Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_037573406.1 BS73_RS16990 acetyl-CoA C-acetyltransferase
Query= BRENDA::P45359 (392 letters) >NCBI__GCF_000744815.1:WP_037573406.1 Length = 406 Score = 300 bits (767), Expect = 6e-86 Identities = 183/411 (44%), Positives = 255/411 (62%), Gaps = 27/411 (6%) Query: 1 MKEVVIASAVRTAIG-SYGKSLKDVPAVDLGATAIKEAVKKAG-IKPEDVNEVILGNVLQ 58 M E VI SA R+ IG ++ SLKDV DL A IK A+ K + P +++++LG L Sbjct: 1 MPEAVIVSAARSPIGRAFKGSLKDVRPDDLSAQIIKAALDKVPELDPTQIDDLMLGCGLP 60 Query: 59 AG-LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMEN 117 G G N AR + + G+ +P TI + C S L+T +A IKAG+ DV I+ G+E Sbjct: 61 GGEQGHNLARVIAVQMGMD-HLPGATITRYCSSSLQTSRMALHAIKAGEGDVFISAGVEC 119 Query: 118 MSRAPYLANNARWGYRMGNAKFVDEMI------TDGLWDAFNDYH-----------MGIT 160 +SR +++ G N F D +G DA++D MG T Sbjct: 120 VSRQVNGSSDGMPGTH--NPVFADAEARTQARSAEGA-DAWHDPRQDGQVPDVYIAMGQT 176 Query: 161 AENIAERWNISREEQDEFALASQKKAEEAIKSGQFKDEIVPVVIKGRKGETVVDTDEHPR 220 AEN+A+ I+R+E DEF + SQ AE+AI G + EI PV + TVV D+ PR Sbjct: 177 AENLAQLKGITRQEMDEFGVRSQNLAEKAIADGFWAREITPVTLPDG---TVVGKDDGPR 233 Query: 221 FGSTIEGLAKLKPAFKKDGTVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGS 280 G T+EG++ LKP F+ DGTVTAGN LND AA LVIMS KA+ELG+ PLA+IVS G Sbjct: 234 AGVTLEGVSGLKPVFRPDGTVTAGNCCPLNDGAAALVIMSDTKARELGLTPLARIVSTGV 293 Query: 281 AGVDPAIMGYGPFYATKAAIEKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVN 340 G+ P IMGYGP A+K A+++AG ++ ++DL+E NEAFAAQ + +DL D++++NVN Sbjct: 294 TGLSPEIMGYGPVEASKQALKRAGLSIGDIDLVEINEAFAAQVIPSYRDLGIDLDRLNVN 353 Query: 341 GGAIALGHPIGASGARILVTLVHAMQKRDAKKGLATLCIGGGQGTAILLEK 391 GGAIA+GHP G +GARI TL++++Q D + GL T+C+GGGQG A+++E+ Sbjct: 354 GGAIAVGHPFGMTGARITTTLINSLQWHDKQFGLETMCVGGGQGMAMVIER 404 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 406 Length adjustment: 31 Effective length of query: 361 Effective length of database: 375 Effective search space: 135375 Effective search space used: 135375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory