Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_037570960.1 BS73_RS09090 3-oxoacyl-ACP reductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000744815.1:WP_037570960.1 Length = 274 Score = 169 bits (428), Expect = 6e-47 Identities = 110/247 (44%), Positives = 138/247 (55%), Gaps = 14/247 (5%) Query: 15 RLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFERLNVTDA 74 RL GR A++TGG GIG AR LA GARV +AD++ G AA E+ G F R +VTDA Sbjct: 23 RLVGRSAVITGGGGGIGLATARRLAAEGARVVVADVDEKAGRAAADEVGGLFMRTDVTDA 82 Query: 75 DAVADLARRLPD----VDVLVNNAGIVRNAPAED-----TPDDDWRAVLSVNLDGVFWCC 125 + V L + VDV NNAGI +P ED T D WR V VNL V+ CC Sbjct: 83 EQVEALFAAAKEAYGSVDVAFNNAGI---SPPEDDSILTTGIDAWRRVQEVNLTSVYLCC 139 Query: 126 REFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRV 185 + M +GRG+I++TAS + Q +Y ASK V+ L+R L ++A G+RV Sbjct: 140 KAALPYMREQGRGSIINTASFVA-VMGAATSQISYTASKGGVLALSRELGVQFAREGIRV 198 Query: 186 NAVAPGYTATPLTRR-GLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGH 244 NA+ PG TPL R + PE L P+GR A EIA AV +LASD ASFVT Sbjct: 199 NALCPGPVDTPLLRELFAKDPERARRRLVHVPVGRFARADEIAAAVAFLASDDASFVTAA 258 Query: 245 TLVVDGG 251 +VDGG Sbjct: 259 QFLVDGG 265 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 274 Length adjustment: 25 Effective length of query: 230 Effective length of database: 249 Effective search space: 57270 Effective search space used: 57270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory