Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_037574474.1 BS73_RS20125 D-2-hydroxyacid dehydrogenase family protein
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000744815.1:WP_037574474.1 Length = 324 Score = 151 bits (382), Expect = 2e-41 Identities = 102/253 (40%), Positives = 135/253 (53%), Gaps = 8/253 (3%) Query: 56 MLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVV 115 +L L+ L T DVA RG+ + T + + A+ ++LIL AR Sbjct: 73 LLARLPELRLLVTTGQANASIDVAAARARGVTVCGTR-MSRYAAAELTWALILELARGAG 131 Query: 116 ELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSA 175 +++G WQ +G L G+TLG++GLGR+G VA A F M+VL R Sbjct: 132 AQDASLRSGGWQAGVGTGL-----DGRTLGVIGLGRLGSRVASIGA-AFGMEVLAWTRHM 185 Query: 176 NPQAEEAYGARRV-ELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRG 234 P+ GA V ELL +D V L + L ET+ +IGAAEL MK +A L+N SRG Sbjct: 186 TPERAAEAGATPVASREELLERSDVVSLHLRLNAETRGIIGAAELARMKPTAWLVNTSRG 245 Query: 235 ATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMA 294 VDE AL AL+ GTI GAGLDV++ EPLP+ SPLL N V PHIG T + Sbjct: 246 PLVDEAALASALRAGTIGGAGLDVYDIEPLPAGSPLLDAPNTVLTPHIGYVTADCFELAY 305 Query: 295 RNAAENLVAALDG 307 +AAE++ A L G Sbjct: 306 GDAAEDVTAWLAG 318 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 324 Length adjustment: 28 Effective length of query: 293 Effective length of database: 296 Effective search space: 86728 Effective search space used: 86728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory