Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_037572577.1 BS73_RS14720 phosphoglycerate dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >NCBI__GCF_000744815.1:WP_037572577.1 Length = 528 Score = 141 bits (355), Expect = 4e-38 Identities = 87/250 (34%), Positives = 129/250 (51%), Gaps = 21/250 (8%) Query: 54 KADGPVLEALHSYGVGLLALRSAGYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIML 113 K D + A + V +A G D++D++ A + G+ VVN P + A+ +++ Sbjct: 53 KMDAEAIAAAQNLKV--IARAGVGLDNVDVQAATKAGVMVVNAPTSNIVTAAELACGLLI 110 Query: 114 ALIRRLHRAHDKVRLGDFDLDGLMGFDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYD 173 + R + A ++ G++ G +L K GV+GLG+IG LVA R+ AFG KV+ YD Sbjct: 111 STARHIPAATAALKQGEWKRSKYTGVELAEKTLGVVGLGRIGVLVAQRMSAFGMKVVAYD 170 Query: 174 PYIQPEI-----VENVDLDTLITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTA 228 PYIQ V+ + LD L+ +D I++H P T E + +E ++KP +VN A Sbjct: 171 PYIQAARAAQMGVKLLSLDELLEVSDFITVHLPKTPETLGLIGDEALHKVKPTVRIVNAA 230 Query: 229 RGGLIDTKALLEALKSGKLGGAALDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLT 288 RGG++D AL+ ALK G++ GA LDVY E D + L G NVV T Sbjct: 231 RGGIVDEGALISALKDGRVAGAGLDVY-----------SSEPCTD---SPLFGFDNVVCT 276 Query: 289 GHQAFLTREA 298 H T EA Sbjct: 277 PHLGASTDEA 286 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 528 Length adjustment: 31 Effective length of query: 294 Effective length of database: 497 Effective search space: 146118 Effective search space used: 146118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory