Align Lactate utilization protein A (characterized)
to candidate WP_037571239.1 BS73_RS10145 (Fe-S)-binding protein
Query= SwissProt::O07020 (238 letters) >NCBI__GCF_000744815.1:WP_037571239.1 Length = 251 Score = 230 bits (586), Expect = 2e-65 Identities = 120/244 (49%), Positives = 152/244 (62%), Gaps = 7/244 (2%) Query: 1 MKVSLFVTCLVDMFQTNVGKATVELLERLGCEVDFPEGQICCGQPAYNSGYVHDAKKAMK 60 M+V+LF+TC+ D G+A V LLERLG EVDFP GQ CCGQP +N+GY + ++ Sbjct: 1 MRVALFLTCVNDAVHPRTGRAVVALLERLGVEVDFPAGQTCCGQPQFNTGYRRATEPLVR 60 Query: 61 RMIETFQDSEYVVSPSGSCTTMFRE-YPHLFQD------DPKWADKAKKLADKTYELTDF 113 RM E F+D EYVVSPSGSC M R+ YP + AD A +L + ELT+F Sbjct: 61 RMDEVFRDYEYVVSPSGSCAAMVRDNYPRIGAKAMAEGRGSALADAAGRLVPRVLELTEF 120 Query: 114 IVNVLGVEDVGATLHTKATLHTSCHMTRLLGVRKEPMKLLSHVKGLQFTELPGKHNCCGF 173 +V+VLGVEDVGA T H SCH R+L + P++LL VKG+ ELPG CCGF Sbjct: 121 LVDVLGVEDVGAYYPHSVTYHPSCHGLRMLRLGDRPLRLLRRVKGIDLRELPGAEECCGF 180 Query: 174 GGTFSVKMAQISEQMVDEKVECVEETGAEVLIGADCGCLMNIGGRLGRKDKNVKVMHIAE 233 GGTFSVK +S M +K TGAE L GAD CL++IGG L R D ++ +H+AE Sbjct: 181 GGTFSVKNPDVSAAMGADKARNALSTGAEALCGADNSCLLHIGGTLRRADAPMRTVHLAE 240 Query: 234 VLNS 237 +L S Sbjct: 241 ILAS 244 Lambda K H 0.321 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 251 Length adjustment: 24 Effective length of query: 214 Effective length of database: 227 Effective search space: 48578 Effective search space used: 48578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory