Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate WP_037577556.1 BS73_RS29620 2-hydroxy-3-oxopropionate reductase
Query= SwissProt::P28811 (298 letters) >NCBI__GCF_000744815.1:WP_037577556.1 Length = 296 Score = 207 bits (527), Expect = 2e-58 Identities = 128/289 (44%), Positives = 167/289 (57%), Gaps = 13/289 (4%) Query: 4 IAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVIS 63 IAF+GLG MG PMAANL+KAGH+V ++ AV LVE G + ADS GAEVVI+ Sbjct: 6 IAFIGLGIMGRPMAANLVKAGHQVTGYNRSRPAVDALVEAGGRAADSVADAVRGAEVVIT 65 Query: 64 MLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVSG 123 MLPA V + G+DG+LA A LLID STI P+T+ V E AA +G+ LDAPVSG Sbjct: 66 MLPADPEVTEVVTGEDGVLAHAAEGTLLIDMSTITPQTSLAVQETAAPRGVRTLDAPVSG 125 Query: 124 GVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILMA 183 G GA G LS +VGG AE A ARPVLE +G I H G HGAGQ K N +++ + Sbjct: 126 GEAGAVEGVLSIMVGGDAEDVAEARPVLEALGTTIVHVGPHGAGQTVKAANQLIVASNIQ 185 Query: 184 GTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASN-GYAGGFQVR 242 AEA+ ++G+D A +V+ G+ LN +A N + GF++ Sbjct: 186 ALAEAVVFLERSGVDLASALDVLGGGLAGSTVLN--------RKRANILNRDFKPGFRID 237 Query: 243 LMNKDLGLALANAQAVQASTPLGALARNLF-SLHAQADAEHEGLDFSSI 290 L +KD+G+ A+AV A P+GAL L S + D GLD S++ Sbjct: 238 LHHKDMGIVTDAARAVGAPLPVGALVAQLVASARSNGDG---GLDHSAL 283 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 296 Length adjustment: 26 Effective length of query: 272 Effective length of database: 270 Effective search space: 73440 Effective search space used: 73440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory