Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate WP_051941112.1 BS73_RS29705 isocitrate lyase/phosphoenolpyruvate mutase family protein
Query= SwissProt::P77541 (296 letters) >NCBI__GCF_000744815.1:WP_051941112.1 Length = 302 Score = 66.2 bits (160), Expect = 8e-16 Identities = 60/170 (35%), Positives = 83/170 (48%), Gaps = 16/170 (9%) Query: 31 ALLAQRAGYQAIYLSGGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGF 90 ALL Q G +A+ + G+AA GLPD LD +L + I +LP VD + G+ Sbjct: 40 ALLGQLPGVRALATTSAGMAAAH-GLPDGERLGLDRLLASLMLIGRSTALPYSVDLEAGY 98 Query: 91 GSSAFNVARTVKSMIKAGAAGLHIED-QVGAKRCGHRPNKAIVSKEE--MVDRIRAAVDA 147 G SA VA +V S+++ GA G+++ED GA P + + + E V R+A D Sbjct: 99 GGSAQEVADSVASVVECGACGVNLEDGDPGA------PGRLLPAGEHATRVAAARSAADQ 152 Query: 148 KTDPDFVIMARTDAL--AVEGLD---AAIERAQAYVEAGAEMLFPEAITE 192 P V+ ARTD +G D A I R Y AGA+ LF E Sbjct: 153 LGVP-IVVNARTDTYWRPYQGPDRFAATIRRLDEYRAAGADCLFVPGFPE 201 Lambda K H 0.319 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 302 Length adjustment: 27 Effective length of query: 269 Effective length of database: 275 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory