Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate WP_037570618.1 BS73_RS07840 zinc-dependent alcohol dehydrogenase family protein
Query= CharProtDB::CH_000596 (353 letters) >NCBI__GCF_000744815.1:WP_037570618.1 Length = 337 Score = 167 bits (424), Expect = 3e-46 Identities = 112/330 (33%), Positives = 165/330 (50%), Gaps = 17/330 (5%) Query: 9 MKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEK-PFI 67 M+A V+ +++ +P P +V+++V A G+CG+DLH G + P I Sbjct: 1 MRAVVIDKPGRVRVTEVPDPTPAAGQVVVEVAACGVCGTDLHILD----GEFPPSPYPLI 56 Query: 68 LGHECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPVDG 127 GHE AG IAA S VG RVAV+P + CGRCE C+ GR NLC D + VDG Sbjct: 57 PGHEFAGTIAA--SDDPALPVGIRVAVDPSLYCGRCEYCRIGRGNLCADWNAVG-DTVDG 113 Query: 128 AFVQYIKMRQDFVFLIPDSL-SYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGL 186 AF QY+ + V +PDS+ + AA+IEP S +H G + ++G G +GL Sbjct: 114 AFAQYVAVPATNVHRLPDSVPDFRTAAMIEPLSCAVHGVDLLGPVLGKRVLVIGSGTMGL 173 Query: 187 MAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDRGVDVAW 246 + GA + V D RL A+ +G T A + RG D+A Sbjct: 174 LIAQLLGRAGASEVAVVDRAGERLTIAQALGFT-------STATSVGELAGGARGFDIAV 226 Query: 247 ETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPF-IADNEIDIYGIFRYANTYPK 305 + G PAA+ S L ++RRGG L + G+ + PF I ++EI I G N+Y Sbjct: 227 DATGAPAAIASGLDALRRGGTLLVFGVADAEAVVPVSPFRIYNDEIRILGSMAVLNSYAP 286 Query: 306 GIEFLASGIVDTKHLVTDQYSLEQTQDAME 335 ++ +A+G VD L+ D Y L+ +A++ Sbjct: 287 AVDLIAAGAVDVAPLLGDAYPLDGYTEAVD 316 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 22 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 337 Length adjustment: 29 Effective length of query: 324 Effective length of database: 308 Effective search space: 99792 Effective search space used: 99792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory