Align FAA hydrolase family protein (characterized, see rationale)
to candidate WP_037577683.1 BS73_RS30775 fumarylacetoacetate hydrolase family protein
Query= uniprot:A0A2E7P912 (281 letters) >NCBI__GCF_000744815.1:WP_037577683.1 Length = 282 Score = 148 bits (373), Expect = 1e-40 Identities = 93/225 (41%), Positives = 122/225 (54%), Gaps = 8/225 (3%) Query: 58 EGSP----RIGACVGNIGKFICIGLNYADHAAESNLPIPAE-PVVFNKWTSAVVGPNDDV 112 EG P +GA V + IGLNY HA ES P P VF K+ +A+ GP + Sbjct: 56 EGEPFDAADLGAPVPAARQIFAIGLNYRAHADESGFDAPEGLPPVFTKFATAITGPVTTL 115 Query: 113 KIPRGSKKTDWEVELGVVIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIERGGT-WDK 171 ++P G DWEVEL VIGK + E D +VAG V DVSER Q+ + Sbjct: 116 ELPEGGHN-DWEVELVAVIGKRAREVAEADGWDYVAGLTVGQDVSERIGQLAGPAPQFSL 174 Query: 172 GKGCDTFGPIGPWLVTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFM 231 GK F P GPW+VT DE +P L + V+G+ Q G T +I V +V+ LS+ + Sbjct: 175 GKSHPGFAPTGPWVVTTDEFDNPDDLELRCTVNGEEMQKGRTRDLIVSVPALVARLSQVL 234 Query: 232 SLQPGDVISTGTPPGVGMGVKPEAVYLRAGQTMRLGIDGLGEQQQ 276 L PGD+I TGTP GVGMG KP+ +L G + I+G+GE +Q Sbjct: 235 PLLPGDIIFTGTPSGVGMGRKPQR-WLADGDLLVSTIEGIGELRQ 278 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 282 Length adjustment: 26 Effective length of query: 255 Effective length of database: 256 Effective search space: 65280 Effective search space used: 65280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory