Protein WP_048081629.1 in Methanobacterium veterum MK4
Annotation: NCBI__GCF_000745485.1:WP_048081629.1
Length: 222 amino acids
Source: GCF_000745485.1 in NCBI
Candidate for 39 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-glutamate catabolism | gltL | med | GluA aka CGL1950, component of Glutamate porter (characterized) | 41% | 88% | 156 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-lysine catabolism | hisP | med | Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) | 41% | 82% | 148.3 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-asparagine catabolism | aatP | med | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 40% | 88% | 145.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-asparagine catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 41% | 88% | 145.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-aspartate catabolism | aatP | med | ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized) | 40% | 88% | 145.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-aspartate catabolism | peb1C | med | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 41% | 88% | 145.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-cellobiose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-galactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-glucose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
lactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-maltose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-mannose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
sucrose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
trehalose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 38% | 61% | 159.8 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 37% | 56% | 150.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-asparagine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 144.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-aspartate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 144.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-glutamate catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 144.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-histidine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 144.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-leucine catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 144.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-proline catabolism | aapP | lo | AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) | 40% | 83% | 144.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 37% | 59% | 144.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 83% | 143.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 39% | 83% | 143.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-alanine catabolism | Pf6N2E2_5405 | lo | ABC transporter for D-Alanine, ATPase component (characterized) | 38% | 85% | 141.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-histidine catabolism | Ac3H11_2560 | lo | ABC transporter for L-Histidine, ATPase component (characterized) | 37% | 84% | 138.7 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-tryptophan catabolism | ecfA2 | lo | Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) | 37% | 77% | 134.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-mannose catabolism | TM1750 | lo | TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 36% | 66% | 125.6 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-fructose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 32% | 83% | 108.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-mannose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 32% | 83% | 108.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
D-ribose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 32% | 83% | 108.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
sucrose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 32% | 83% | 108.2 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-proline catabolism | HSERO_RS00900 | lo | ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) | 32% | 84% | 95.1 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-alanine catabolism | braG | lo | NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 30% | 90% | 94.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-histidine catabolism | natE | lo | NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 30% | 90% | 94.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-leucine catabolism | natE | lo | NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 30% | 90% | 94.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-proline catabolism | natE | lo | NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 30% | 90% | 94.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-serine catabolism | braG | lo | NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 30% | 90% | 94.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
L-threonine catabolism | braG | lo | NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) | 30% | 90% | 94.4 | Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- | 45% | 199.1 |
Sequence Analysis Tools
View WP_048081629.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MNDINVIEIKGLKKSYEEGQITALNGIDLEIKEGEFVSIIGPSGSGKSTLLNMIGALDNP
DEGSISVAGTDLTRSEDLSKFRSDEIGFVFQLHNLIPNLTVFENVQIPLIETPLSDEQME
KRALELLKSVNLENKINQKPTKLSGGERQRVAIARALVNHPSIILADEPTGSLDSKTQEI
ILDLLKDIHKKENVTLIIVTHSPDVATMADRIITVLDGEIKG
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory