Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_048081629.1 EJ01_RS04900 ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000745485.1:WP_048081629.1 Length = 222 Score = 139 bits (349), Expect = 7e-38 Identities = 86/223 (38%), Positives = 134/223 (60%), Gaps = 7/223 (3%) Query: 17 VSDEIAIQISQMNKWY--GQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEH 74 ++D I+I + K Y GQ L I+L + GE + I GPSGSGKST++ I L+ Sbjct: 1 MNDINVIEIKGLKKSYEEGQITALNGIDLEIKEGEFVSIIGPSGSGKSTLLNMIGALDNP 60 Query: 75 QSGKIIVDGIELTSDLKNIDKVRS-EVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKRE 133 G I V G +LT +++ K RS E+G VFQ NL P+LT+ EN+ + P+ + + Sbjct: 61 DEGSISVAGTDLTRS-EDLSKFRSDEIGFVFQLHNLIPNLTVFENVQI-PLIETPLSDEQ 118 Query: 134 AEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMI 193 E+ A+ L+ V + + + P +LSGG++QRVAIAR+L P I+L DEPT +LD + Sbjct: 119 MEKRALELLKSVNLENKINQKPTKLSGGERQRVAIARALVNHPSIILADEPTGSLDSKTQ 178 Query: 194 KEVLDTMIQL-AEEGMTMLCVTHEMGFAQAVANRVIFMADGQI 235 + +LD + + +E +T++ VTH A +A+R+I + DG+I Sbjct: 179 EIILDLLKDIHKKENVTLIIVTHSPDVA-TMADRIITVLDGEI 220 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 222 Length adjustment: 23 Effective length of query: 240 Effective length of database: 199 Effective search space: 47760 Effective search space used: 47760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory