Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_048082461.1 EJ01_RS14630 polysaccharide biosynthesis protein
Query= SwissProt::Q9ZDJ5 (341 letters) >NCBI__GCF_000745485.1:WP_048082461.1 Length = 364 Score = 227 bits (579), Expect = 3e-64 Identities = 124/291 (42%), Positives = 180/291 (61%), Gaps = 11/291 (3%) Query: 2 FVDKTLMITGGTGSFGNAVLSRFLKSNIINDIKEIRIFSRDEKKQEDMRIALNNSKLKFY 61 + DK +++TGGTGS G+ ++ + L+ + K +R+ +E ++ LN+ K++ Sbjct: 5 YKDKVVLVTGGTGSIGSEIVKKLLE----HGPKVVRVLDNNETSLFELEHDLNSDKIRTL 60 Query: 62 IGDVRNYQSIDDAMHGVDYVFHAAALKQVPTCEFYPMEAINTNVLGAENVLSAAINNKVT 121 +GD+R+ + + A GVD VFHA ALK VP CEF P +A+ TNV+G +NVL+AA++ V+ Sbjct: 61 MGDIRDKERLMRAFEGVDIVFHAGALKHVPLCEFNPFDAVKTNVIGTQNVLNAALDQGVS 120 Query: 122 KVIVLSTDKAVYPINAMGLSKALMEKLAIAKARMRSPGETILCVTRYGNVMASRGSVIPL 181 KVIV+STDKAV PIN MG +K L E+L I+ ET+ R+GNV+ SRGSV+PL Sbjct: 121 KVIVISTDKAVNPINVMGATKLLAERLTISANNYTGDKETVFSCVRFGNVLDSRGSVVPL 180 Query: 182 FIHQIKQGKELTITEPSMTRFLMSLVDSVDLVLYAFEHGRQGDIFVQKSPASTI----EV 237 F QIK+G +TIT P MTRF+M + +V L+L A E +IF+ K PA I EV Sbjct: 181 FKSQIKKGGPVTITSPDMTRFIMGIPQAVQLILKAGEISEGKEIFILKMPALNIVDLAEV 240 Query: 238 LAKALQEIFGSKN---AIRFIGTRHGEKHYESLVSSEDMAKADDLGGYYRI 285 + + ++G K I+ IG R GEK YE L++ ++ A D G Y I Sbjct: 241 MIEEFAPLYGYKPEDIEIQIIGKRIGEKTYEELMTEDETVNAVDQGKLYII 291 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 364 Length adjustment: 29 Effective length of query: 312 Effective length of database: 335 Effective search space: 104520 Effective search space used: 104520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory