Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate WP_048082709.1 EJ01_RS16035 polysaccharide biosynthesis protein
Query= curated2:A8GWP0 (341 letters) >NCBI__GCF_000745485.1:WP_048082709.1 Length = 331 Score = 219 bits (559), Expect = 6e-62 Identities = 132/334 (39%), Positives = 190/334 (56%), Gaps = 26/334 (7%) Query: 5 KTLLITGGTGSFGNAVLSRFLKNDIIKDIKEIRIFSRDEKKQEDMRIALNNPKIKFYIGD 64 KT+L+TGG GS G+ ++ L+ D K IR+ +E ++ LN+ KI+ IGD Sbjct: 13 KTILVTGGAGSIGSEIVRNLLE----LDPKAIRVLDNNETGLFELEQELNSDKIRTLIGD 68 Query: 65 VRNYNSIDDAMKDVDYVFHAAALKQVPTCEFYPMEAINTNILGAENVLRAATINKVAKVI 124 +R+ + A + VD +FHAAALK VP CE+ P +A+ TN++G +NVL AA V K I Sbjct: 69 IRDKERLMRAFEGVDIIFHAAALKHVPLCEYNPFDAVKTNVIGTQNVLDAALDQNVGKAI 128 Query: 125 VLSTDKAVYPINAMGLSKALMEKLAIAKARMNVRDKTVFCVTRYGNVMASRGSVIPLFIN 184 V+STDK V P+N MG +K L E+L I+ KTVF R+GNV+ SRGSV+P+F N Sbjct: 129 VISTDKTVNPVNVMGATKLLAERLTISANYYKGDKKTVFSCVRFGNVLDSRGSVVPIFKN 188 Query: 185 QIKQNKDLTITEPSMTRFLMSLVDSVDLVLYAFEYGHQGDIFVQKSPASTIEVLAKA--- 241 QIK +TIT+ MTRF+M + +V L++ A +IF+ K PA I LAKA Sbjct: 189 QIKNGGPVTITDYEMTRFVMGIPQAVGLIIKAGVIAEGNEIFILKMPAVNIIDLAKAMID 248 Query: 242 ----LQGIFNSKNKIRFIGTRHGEKHYESLVSSEEMAKAEDLGNYYRIPMDGRDLNYAKY 297 + G + KI IG R GEK +E L++ +E+ MD DL Y Sbjct: 249 ELSPIYGYKPEEIKIEIIGKRLGEKLFEELMNEDELDYV----------MDNGDL----Y 294 Query: 298 FVEGEKKIALLE-DYTSHNTKRLNLEEVKELLLN 330 + E+ + E Y S+N +LN +++K++L N Sbjct: 295 ILNSERVLKKPEIHYNSNNALKLNKKQIKDVLKN 328 Lambda K H 0.319 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 331 Length adjustment: 28 Effective length of query: 313 Effective length of database: 303 Effective search space: 94839 Effective search space used: 94839 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory