Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate WP_048081400.1 EJ01_RS05520 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >NCBI__GCF_000745485.1:WP_048081400.1 Length = 348 Score = 168 bits (425), Expect = 2e-46 Identities = 96/306 (31%), Positives = 169/306 (55%), Gaps = 5/306 (1%) Query: 21 DYALLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQER 80 ++ + + ++ ED + +LGPSG GKT +L +++G+ GK+ D +D+T P++R Sbjct: 13 EFKINNINLQVEDSEYFIILGPSGSGKTMLLELIAGMWPLDSGKIYMDNKDITTLPPEKR 72 Query: 81 NIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLA 140 I V+Q +++ TV EN+AF L+ RKV + +IK RV + ++L++S ++ L+ Sbjct: 73 GIGFVYQNYMLFPHKTVFENIAFGLKVRKVRDEEIKTRVKEMMDLLKISHLADRLPRTLS 132 Query: 141 ADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQ 200 +Q+ +L R L+ +L DEPL+ +D + +L ++LK+IH + +TL++VTH+ Sbjct: 133 GGEQQRTALARALI-IYPKILLMDEPLSALDRKTRDELMQELKEIHRKFDVTLVHVTHNF 191 Query: 201 VEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPAHRDGENLSVA 260 EAL AD++ +M G+ QVG++ +F PA FV F+G+ + A +DGE L++ Sbjct: 192 DEALMLADRIAIMRNGEISQVGTSTEIFRHPADKFVADFVGAENIIEGTAKKDGERLTII 251 Query: 261 GHRLASPVGRALPAGALQVGIRPEYLALA----QPQQAGALPGTVVQVQDIGTYQMLTAK 316 S G + + +RPE + L+ + G++ + D G LT Sbjct: 252 DTGNISIYSTEQKQGHVHITVRPEDIILSTQKVETSARNVFKGSIRGIVDTGALIKLTID 311 Query: 317 VGEHTV 322 VGE V Sbjct: 312 VGEPLV 317 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 348 Length adjustment: 29 Effective length of query: 329 Effective length of database: 319 Effective search space: 104951 Effective search space used: 104951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory