Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate WP_048081741.1 EJ01_RS09045 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >NCBI__GCF_000745485.1:WP_048081741.1 Length = 249 Score = 95.5 bits (236), Expect = 1e-24 Identities = 60/181 (33%), Positives = 102/181 (56%), Gaps = 10/181 (5%) Query: 39 LLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQERNIAQVFQFPVIYDTMTVA 98 +LGPSGCGK+T+L +++GL PS G++L D + + VFQ ++ +V Sbjct: 38 ILGPSGCGKSTILRLIAGLDKPSSGQILMDNEAIMGPGCK---CGMVFQEYSLFPWRSVI 94 Query: 99 ENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAA---GLAADAKQKISLGRGLVR 155 EN+AFPL + V E ++R + + L++ G N R + L+ KQ++++ R L Sbjct: 95 ENVAFPLEMKGVAE---EERHKIAEDYLKIVGLQNFRDSMPHELSGGMKQRVAIVRSLA- 150 Query: 156 ADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTFADQVVVMTR 215 D +L DEP +D + QL++ L I + T+++VTHD EA+ D+V++M++ Sbjct: 151 GDPDILLMDEPFGALDIQTRSQLQKDLLNIWEDKGKTIVFVTHDIDEAIFLGDRVILMSK 210 Query: 216 G 216 G Sbjct: 211 G 211 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 249 Length adjustment: 27 Effective length of query: 331 Effective length of database: 222 Effective search space: 73482 Effective search space used: 73482 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory