Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_048081777.1 EJ01_RS09235 ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_000745485.1:WP_048081777.1 Length = 226 Score = 149 bits (377), Expect = 5e-41 Identities = 75/210 (35%), Positives = 129/210 (61%), Gaps = 5/210 (2%) Query: 1 MIEFHDVHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGG 60 +I +++ KTY++ E+ AL+ + + G+ ++G SG+GKSTLL +I L+ P+ G Sbjct: 4 LINGNELWKTYKLDSTEVHALRGLNITVGEGEFVSIMGPSGSGKSTLLNMIGGLDNPTKG 63 Query: 61 RILVEGEDVTALDAEGLRRFR-QRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVD 119 + ++G+D++ + L R R +++G IFQ FNLL + TV DN+ P+R G + Sbjct: 64 DLFIDGKDISRMSEGELTRMRAEKIGFIFQTFNLLPALTVRDNVEFPMRNLNGSKKMNKS 123 Query: 120 ARVS---ELLARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQT 176 +R+ E + VGL D PA+LSGG++QRV +ARAL P +L DE T LD ++ Sbjct: 124 SRIKKAEECIEIVGLGDRMDYLPAKLSGGERQRVAVARALVNNPKFILADEPTGNLDSES 183 Query: 177 TASVLQLLAEINRELKLTIVLITHEMDVIR 206 T +++ LL E+N+ + T++++TH+ + + Sbjct: 184 TENIINLLHEVNQN-ETTVIMVTHDAETTK 212 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 226 Length adjustment: 25 Effective length of query: 310 Effective length of database: 201 Effective search space: 62310 Effective search space used: 62310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory