GapMind for catabolism of small carbon sources

 

Alignments for a candidate for bamF in Methanobacterium veterum MK4

Align Benzoyl-CoA reductase electron transfer protein, selenocysteine-containing, putative (characterized, see rationale)
to candidate WP_048082403.1 EJ01_RS14295 hydrogenase iron-sulfur subunit

Query= uniprot:Q39TW2
         (255 letters)



>NCBI__GCF_000745485.1:WP_048082403.1
          Length = 134

 Score =  136 bits (343), Expect = 2e-37
 Identities = 59/131 (45%), Positives = 86/131 (65%), Gaps = 1/131 (0%)

Query: 8   KPSVVGFLCTWUAYGAADLAGVSRLQYTTETKIIRVMCTGRVDLAFVLRAFSKGADGVFI 67
           +P +VGF C W  YG AD AG +R+QY    +IIRVMC+GR++   +L+AF +GADGVF+
Sbjct: 3   EPKIVGFCCNWCCYGGADTAGTARMQYPPGVRIIRVMCSGRINPEMILKAFKEGADGVFV 62

Query: 68  GGCWPGECHYVTEGNYDVLKNVHIAKKILERIGINPDRLRLEWIAASEGMRYAEVMNDFG 127
           GGC  G+CHY   GNY   +     + ++   GI+ +R R EWI+ASEG ++ + M +F 
Sbjct: 63  GGCHIGDCHY-DSGNYKWKRRAKFIEDLIPEFGIDKERFRFEWISASEGEKFQKTMKEFY 121

Query: 128 KRLKELGPLGK 138
             +K +GP+ K
Sbjct: 122 NCIKSIGPIQK 132


Lambda     K      H
   0.321    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 93
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 255
Length of database: 134
Length adjustment: 19
Effective length of query: 236
Effective length of database: 115
Effective search space:    27140
Effective search space used:    27140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 44 (21.6 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory