Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_048082005.1 EJ01_RS03845 branched-chain amino acid transaminase
Query= BRENDA::P0AB80 (309 letters) >NCBI__GCF_000745485.1:WP_048082005.1 Length = 307 Score = 333 bits (853), Expect = 4e-96 Identities = 157/296 (53%), Positives = 214/296 (72%), Gaps = 1/296 (0%) Query: 9 IWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIY 68 IWFNGE V W+DA +HV+SH +HYG+SVFEGIRCY++ KG V R REH++RL +S KIY Sbjct: 9 IWFNGEFVNWKDANIHVLSHVVHYGSSVFEGIRCYNTKKGSAVLRLREHVERLFNSGKIY 68 Query: 69 RFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWG 128 R + ++DE+ +A + ++ NNL YIRP+ F G +GV P D +IAA+ WG Sbjct: 69 RMEIPYTVDEICDAIIETVKVNNLKDCYIRPIAFRGYRELGVYP-LNCPMDTVIAAWEWG 127 Query: 129 AYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDV 188 YLG +A+E G+D VS+W R APNT+P AKAG NY++S L E+ +G+ E I LD Sbjct: 128 KYLGDDAIENGVDIGVSTWRRMAPNTLPNMAKAGANYMNSQLAKMESVSNGFDEAIMLDY 187 Query: 189 NGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLY 248 +G +SEG+GEN+F VKDG L+TP + S L GITRD+I KLA+++ I+V E+ + RE LY Sbjct: 188 HGTVSEGSGENIFLVKDGELYTPHASLSLLSGITRDSITKLAQDMEIKVNEEAIPREMLY 247 Query: 249 LADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWL 304 LADE+FM+GTAAE+TPVRSVDGI++G G+ G +T+++Q FF + G ED+ GWL Sbjct: 248 LADEIFMTGTAAEVTPVRSVDGIKIGNGKRGEITEKLQTKFFNIVGGVEEDEHGWL 303 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 307 Length adjustment: 27 Effective length of query: 282 Effective length of database: 280 Effective search space: 78960 Effective search space used: 78960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory