Align Iron-sulfur cluster-binding oxidoreductase, CCG domain pair-containing, putative benzoyl-CoA reductase electron transfer protein (characterized, see rationale)
to candidate WP_048082693.1 EJ01_RS15925 (Fe-S)-binding protein
Query= uniprot:Q39TW0 (387 letters) >NCBI__GCF_000745485.1:WP_048082693.1 Length = 224 Score = 153 bits (387), Expect = 4e-42 Identities = 93/236 (39%), Positives = 128/236 (54%), Gaps = 15/236 (6%) Query: 150 LLYFTGCYLSYDPRMRKVAAATAAILNKAGVDFGILGSKESCCGESIRKTGNEELFKRLA 209 ++YF GC ++ +A AT IL +AG+D+ IL E+CCG + +TG + K + Sbjct: 1 MIYFRGCVAR--EKLNNIADATEKILKQAGIDYKIL-ENETCCGSFLLRTGFAQDAKEVM 57 Query: 210 KENIKQFIDNGVTKILVSSPHCYHTFVNEYPEFK-VNFEVVFISQYIGQLINEGRLQITG 268 K +K+ G KI+ S CY TF +Y E V +V+ SQ LI +G ++ Sbjct: 58 KNTLKEI---GEEKIITSCAGCYKTFKKDYKEILGVELDVIHTSQLFNDLIKKGEIEPLF 114 Query: 269 EFAKKVTYHDPCYLGRHNGIYDEPRQVLQQVPGLELLEMADNRESSLCCGGGGGRIWMET 328 K VTYHDPC+LGRH YD PR++L + L+EM N+E S CCG GGG Sbjct: 115 -LDKTVTYHDPCHLGRHLEEYDAPREILDNI--TNLVEMDRNKEKSRCCGAGGGVRAAFP 171 Query: 329 PKEERFADLRIRQAVDVGATVLATSCPYCITNFTDSSLDLADHEKVEVKDLAEIIL 384 E A +RI+ A DV A +L TSCP+CI N S D +V DL+EII+ Sbjct: 172 EITENIAKMRIKDAEDVEAEILVTSCPFCILNLKSVSKD-----DKKVLDLSEIII 222 Lambda K H 0.320 0.139 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 224 Length adjustment: 26 Effective length of query: 361 Effective length of database: 198 Effective search space: 71478 Effective search space used: 71478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory