Align Indolepyruvate oxidoreductase subunit IorB; IOR; Indolepyruvate ferredoxin oxidoreductase subunit beta; EC 1.2.7.8 (characterized)
to candidate WP_048080134.1 EJ01_RS01355 indolepyruvate oxidoreductase
Query= SwissProt::P80911 (196 letters) >NCBI__GCF_000745485.1:WP_048080134.1 Length = 197 Score = 236 bits (601), Expect = 3e-67 Identities = 114/192 (59%), Positives = 149/192 (77%) Query: 3 YNIYVCGVGGQGIIKTSVIIGEAAMNEGMNVVMSEIHGMAQRGGAVSTEIRFGDVRGSII 62 YNIY+CGVGGQGIIKTS++IGEAAM M VVMSE+HGMAQRGG VSTE++ G+ + II Sbjct: 4 YNIYICGVGGQGIIKTSIVIGEAAMKSDMGVVMSEVHGMAQRGGVVSTELKIGNSKSPII 63 Query: 63 PQGEADLVIAFEPLEALRALPKMSEDACVIVNTSKIPPFNLIKSPHPYPPLEEIIKTLEE 122 +G ADL+IAFEP+EALRA+PK S+D VIVNTS I PFN+I S PYP +++I+ L+ Sbjct: 64 EKGSADLLIAFEPMEALRAIPKASKDTYVIVNTSPIMPFNIIGSEVPYPKIQDILDELKS 123 Query: 123 NAGRVRSFNGEKIAVEAGHILSLNMVMLGAAAATTGFPLGEETLIESMKNNLPPKLMEVN 182 V + + EK A EAGHILSLNMVMLG + A +GFP+ +E +++SMK NLP K + +N Sbjct: 124 KVKDVFALDAEKAAKEAGHILSLNMVMLGGSTAVSGFPIDKEAVLKSMKANLPQKSIPIN 183 Query: 183 LRAFHEGFETVN 194 ++A+ +GFE V+ Sbjct: 184 MKAYEKGFEFVS 195 Lambda K H 0.317 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 197 Length adjustment: 20 Effective length of query: 176 Effective length of database: 177 Effective search space: 31152 Effective search space used: 31152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory