Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_048081629.1 EJ01_RS04900 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000745485.1:WP_048081629.1 Length = 222 Score = 88.6 bits (218), Expect = 9e-23 Identities = 65/210 (30%), Positives = 119/210 (56%), Gaps = 12/210 (5%) Query: 4 NILKVQQLSVAY--GGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVE 61 N+++++ L +Y G I A+ GIDLE+ EGE V++IG +G+GK+T L I G L + E Sbjct: 5 NVIEIKGLKKSYEEGQITALNGIDLEIKEGEFVSIIGPSGSGKSTLLNMI-GALD-NPDE 62 Query: 62 GHIEYLGQPLKGKKSFELVK-DKLAMVPEGRGVFTRMSIQENL---LMGAYTSDDKGQIA 117 G I G L + + D++ V + + +++ EN+ L+ SD++ + Sbjct: 63 GSISVAGTDLTRSEDLSKFRSDEIGFVFQLHNLIPNLTVFENVQIPLIETPLSDEQMEKR 122 Query: 118 ADIDKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVE 177 A ++ +V L+ + Q LSGGE+Q +A+ARAL++HP ++L DEP+ L E Sbjct: 123 A-LELLKSV--NLENKINQKPTKLSGGERQRVAIARALVNHPSIILADEPTGSLDSKTQE 179 Query: 178 KIFEVIRNV-SAQGITILLVEQNAKLALEA 206 I ++++++ + +T+++V + +A A Sbjct: 180 IILDLLKDIHKKENVTLIIVTHSPDVATMA 209 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 121 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 222 Length adjustment: 23 Effective length of query: 218 Effective length of database: 199 Effective search space: 43382 Effective search space used: 43382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory