Align sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_048080142.1 EJ01_RS01405 hypothetical protein
Query= metacyc::MONOMER-17164 (369 letters) >NCBI__GCF_000745485.1:WP_048080142.1 Length = 399 Score = 97.4 bits (241), Expect = 6e-25 Identities = 70/207 (33%), Positives = 94/207 (45%), Gaps = 20/207 (9%) Query: 31 PNLQTDRDVIVQVIVTGLCGSDIHYWQHGRIGRYVVEAPIVLGHESAGIVVECGSKSGFA 90 P + D IV++ + +CGSD+H + G E+ LGHE G+V E G Sbjct: 20 PKISKPTDAIVRITSSAICGSDLHMYD----GETTFESGRTLGHEPMGVVEEVGDAVQLV 75 Query: 91 I-GDRVALEPGIACNTCHHCRAGRYNLC---------SAMRFAATPPYDGTLATYYRLPA 140 GDRV + IAC C +C G N C SA + PY G A Y +P Sbjct: 76 KPGDRVVMPFNIACGFCLNCIQGLTNACLTLNPDQPGSAYGYVNMGPYQGGQAEYVLVPY 135 Query: 141 E--CCYKLPAHVSLQHG----ALVEPLSVAVHSCRLAGDMQQKSVVVFGAGPVGLLCASV 194 C KLP + L + + +S LA K+V VFGAGPVGLL A Sbjct: 136 ADWACLKLPGEPGDEFEDDFVLLADIFPTSYYSTELANVSIGKAVAVFGAGPVGLLAAYS 195 Query: 195 SRAFGASTVVVVDINSDRLSVAQKYGA 221 + GAS V ++D + +RL A+ GA Sbjct: 196 AILKGASEVYIIDDSEERLKRAESIGA 222 Lambda K H 0.321 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 399 Length adjustment: 30 Effective length of query: 339 Effective length of database: 369 Effective search space: 125091 Effective search space used: 125091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory