Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_048080275.1 EJ01_RS02135 phosphoglucosamine mutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000745485.1:WP_048080275.1 Length = 451 Score = 345 bits (885), Expect = 2e-99 Identities = 196/458 (42%), Positives = 277/458 (60%), Gaps = 19/458 (4%) Query: 3 KLFGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALI 62 +LFGT G+RG +IT +GMA T + +GRK V+G DTR S +M++ A+I Sbjct: 7 RLFGTSGIRGKIGSEITLNLITDVGMAAATYVGGKGRK---AVIGYDTRTSNKMVENAII 63 Query: 63 SGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKK 122 +G+L GCDVI +G+ PTP V +A NAD G +ITASHNP +YNGIKL P GM + Sbjct: 64 AGILQCGCDVIRLGMVPTPLVGYAAMKLNADIGIMITASHNPSQYNGIKLWNPKGMAYTQ 123 Query: 123 EREAIVEELFFKEDFDRAKWYEIGEVR-REDIIKPYIEAIKSKVDVEAIKKRKPFVVVDT 181 ++E +E++ ++ F + W IG+++ II Y++ + + VD++ K VVVD Sbjct: 124 DQERTIEKIVHEKTFSKVSWEHIGDIKDNSSIISGYMDDLLNNVDIKGGLK----VVVDC 179 Query: 182 SNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADFGVA 241 +NGAGS P +LR+ GC+V+T+N+QPDG+FP R PEP+E NL E M++VKA GAD G+A Sbjct: 180 ANGAGSFVSPTVLRKAGCEVLTLNSQPDGFFPGRMPEPSEANLSELMKVVKATGADIGIA 239 Query: 242 QDGDADRAVFIDENGRFIQGDKTFALVADAVLKEKGGGLLVTTVATSNLLDDIAKKHGAK 301 DGDADR V ID+ G+ DK ALV+ + GG +VTTV S +D K+ G + Sbjct: 240 HDGDADRMVAIDDEGKMADFDKLLALVSSKI-----GGKIVTTVDASFCVDKCMKESGGE 294 Query: 302 VMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKSGKKFS 361 V+RTKVGD+ VA A+ E N GGE +G + P+ + DG ++ KV+EI K G S Sbjct: 295 VVRTKVGDVHVAEAIVECNAAFGGEPSGTWLHPDFCMCPDGILSALKVIEIVEKYG-PLS 353 Query: 362 ELIDELPKYYQIKTKRHVEG-DRHAIVNKVAEMAR---ERGYTVDTTDGAKIIFEDG-WV 416 +L++E+P Y ++ K E + I+ KV E E V+ DG +I +DG WV Sbjct: 354 KLLNEIPSYPTVRDKIECENIQKTLIMEKVKEELPDYFEDVNDVNFIDGVRISMKDGSWV 413 Query: 417 LVRASGTEPIIRIFSEAKSKEKAQEYLNLGIELLEKAL 454 L+R SGTE IRI E ++ E AQ E +E L Sbjct: 414 LIRPSGTESYIRITLEGRNVEIAQSIRTKSREFIEGIL 451 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 529 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 451 Length adjustment: 33 Effective length of query: 422 Effective length of database: 418 Effective search space: 176396 Effective search space used: 176396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory