Align Alcohol dehydrogenase; EC 1.1.1.1; EC 1.1.1.4; EC 1.2.1.3 (characterized)
to candidate WP_048081448.1 EJ01_RS05805 NAD(P)-dependent alcohol dehydrogenase
Query= SwissProt::Q0KDL6 (366 letters) >NCBI__GCF_000745485.1:WP_048081448.1 Length = 356 Score = 217 bits (552), Expect = 4e-61 Identities = 126/343 (36%), Positives = 188/343 (54%), Gaps = 21/343 (6%) Query: 5 MKAAVFVEPGRIELADKPIPDIGPNDALVRITTTTICGTDVH-ILKGEYPVAKGLTVGHE 63 MK ++ G +K P GP DA+VR T C +DVH + +G + +GHE Sbjct: 1 MKGFAMLKIGETGWIEKDRPKCGPRDAIVRPTCLAPCTSDVHTVWEGAIGDRHNMILGHE 60 Query: 64 PVGIIEKLGSAVTGYREGQRVIAGAICPNFNSYAAQDGVASQDGSYLMASGQCGCHGYKA 123 VGI++++G+ V ++ G RVI AI P+++S A Q G SQ G G CG Sbjct: 61 AVGIVDEVGTEVKDFKPGDRVIVPAITPDWDSEAVQRGFPSQTG------GACG------ 108 Query: 124 TAGWRFGNMIDGTQAEYVLVPDAQANLTPIPDGLTDEQVLMCPDIMSTGFKGAENANIRI 183 GW++ N DG E+ V A NL +P+G++ E +M D+MSTGF GAENA I + Sbjct: 109 --GWKYSNFKDGVFGEFFHVNLADNNLAHLPEGMSQEAAVMITDMMSTGFMGAENAGIEL 166 Query: 184 GDTVAVFAQGPIGLCATAGARLCGATTIIAIDGNDHRLEIARKMGADVVLNFRNCDVVDE 243 G TVAV G +GLC AGA+L GA I A+ +E+A+K GA ++++R+ D ++ Sbjct: 167 GSTVAVLGIGAVGLCGIAGAKLRGAGRIFAVGTRPVSVEVAKKYGATDIISYRDGDTAEQ 226 Query: 244 VMKLTGGRGVDASIEALGTQATFEQSLRVLKPGGTLSSLGVYSSDL----TIPLS--AFA 297 ++ T G GVDA I + G + ++ K G +S+ + T+PL + Sbjct: 227 ILDATDGEGVDAVIISGGGPDILIDACKMAKAGSKISNNNYFGKGEGEKDTLPLCRVGWG 286 Query: 298 AGLGDHKINTALCPGGKERMRRLINVIESGRVDLGALVTHQYR 340 G+ D I T LCPGG+ RM RL +++ GR+D LVTH+++ Sbjct: 287 FGMADKDIITGLCPGGRVRMERLADIVTYGRMDPELLVTHKFK 329 Lambda K H 0.320 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 356 Length adjustment: 29 Effective length of query: 337 Effective length of database: 327 Effective search space: 110199 Effective search space used: 110199 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory