Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, ATPase component (characterized)
to candidate WP_048082401.1 EI99_RS13040 ATP-binding cassette domain-containing protein
Query= reanno::pseudo3_N2E3:AO353_16275 (244 letters) >NCBI__GCF_000746075.1:WP_048082401.1 Length = 279 Score = 140 bits (352), Expect = 3e-38 Identities = 93/252 (36%), Positives = 137/252 (54%), Gaps = 12/252 (4%) Query: 1 MISIKNVNKWYGD-FQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVV 59 +I KNV Y D L + + G++I + GP+G+GKSTL N + G V+ Sbjct: 3 IIETKNVTYQYPDGTNALENINFSAPTGKIIALLGPNGAGKSTLFLHFNGILQPTSGSVM 62 Query: 60 VDGTSIADPKTDLPKLRSRVGMVFQH--FELFPHLTITENLTIAQIKVLGRSKEEATKKG 117 VD + K DL LR +VG+VFQ+ +LF T+ E++ + LG SKEE K+ Sbjct: 63 VDNACLNYKKEDLMNLRQKVGIVFQNPDDQLFAP-TVVEDVAFGPVN-LGLSKEEVKKRV 120 Query: 118 LQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEVLD 177 + L RV + HK P LSGGQ++RVAIA LAM P +M+ DEPTS LDP ++++ Sbjct: 121 DESLRRVEMIEFKHKAPHHLSGGQKKRVAIAGILAMHPKIMVLDEPTSGLDPRGASKIMK 180 Query: 178 VMVQLANEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFFGD------INARS 231 ++ +L EG+T++ TH++ A V + +G II+ +E F D N R Sbjct: 181 LLYELNREGITIIISTHDVDLVPLYAHSVYIISKGNIIKKGSPQEVFEDAETIRKANLRL 240 Query: 232 DRAQHFLDKILQ 243 R H ++ ILQ Sbjct: 241 PRIAHLVE-ILQ 251 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 279 Length adjustment: 25 Effective length of query: 219 Effective length of database: 254 Effective search space: 55626 Effective search space used: 55626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory