Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_048081429.1 EI99_RS07905 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000746075.1:WP_048081429.1 Length = 260 Score = 152 bits (384), Expect = 7e-42 Identities = 78/227 (34%), Positives = 130/227 (57%) Query: 15 DKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSSRQL 74 + + NDV+LSL G + ++GPNG GKSTL+ C + LL SG + + + I+ L+ L Sbjct: 18 EDIFNDVNLSLENGDVLCILGPNGTGKSTLIKCMNGLLKLNSGNILINNQSIHSLNKNDL 77 Query: 75 ARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRINHLAVR 134 A+ + +PQ H + +V ++V GR P LSL +D A+ I+HL + Sbjct: 78 AKIIGYIPQSHNSTFAFSVFDVVLMGRAPHLSLTSVPGEKDCKIAEEALKSLGISHLTDK 137 Query: 135 RLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQGKTVVAV 194 TE+SGG+RQ +A VLAQ ++LLDEPT++LD +Q+ + ++ +L G +V+ Sbjct: 138 TYTEISGGERQMVLIARVLAQQPQILLLDEPTSHLDFGNQIRTLDVINKLAENGLSVIMT 197 Query: 195 LHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEI 241 H + A +++ +M G +M GTPE V+T +R ++++ +I Sbjct: 198 SHFPDHAFLSSNKVAIMNGGTIMEMGTPESVITEENMRRAYNIDVKI 244 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory