Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_048080438.1 EI99_RS03055 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000746075.1:WP_048080438.1 Length = 409 Score = 223 bits (568), Expect = 1e-62 Identities = 149/414 (35%), Positives = 222/414 (53%), Gaps = 26/414 (6%) Query: 5 TIRDVDLKGKRVIMRVDFNVPV--KDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGR 62 TI D +L+ K V++RVD N PV G + DDTRI+ TI ++GAK ++L+H R Sbjct: 7 TIDDFNLEDKTVLVRVDINSPVDPSTGSILDDTRIKLHAETIDEISKKGAKTVVLAHQSR 66 Query: 63 PKGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPG 122 P + +L AK LS +L + V ++ + G ++ ++ LK+G++LLLEN RF+ Sbjct: 67 PGKKDFT--TLQQHAKALSNILNRPVDYIDDIFGTAAREEIKRLKKGDILLLENVRFYSE 124 Query: 123 ET-KNDPE------LAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEI 175 E K DP + + + DI +NDAF AHR+ S VG A +PS AG +MEKE+ Sbjct: 125 EILKRDPHQQAETHMVRKLYPIIDIFINDAFAAAHRSQPSLVGFAVKLPSGAGRIMEKEL 184 Query: 176 KFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLME--KADRILIGGAMMFTFLKALGKEV 233 K L N EKP V VLGG KV D I V+ N++ AD +L G + FL A G + Sbjct: 185 KSLYGAVDNAEKPCVYVLGGVKVDDSIMVLENVLRNGSADYVLTTGLVANIFLWAAGINL 244 Query: 234 GSSR----VEEDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPE 289 G + + ID ++ + +E +I +P D + +V IP Sbjct: 245 GKYNEDFIINKGYIDFVEKGKQLLEEFDGQIKMPDDVAVCVD-----NARVEYCTKNIPN 299 Query: 290 GWMGLDIGPETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAIT 349 + DIG TI + + + DAKT+ NGP GVFE + F+ GT+ + IA+ + Sbjct: 300 KPI-YDIGTNTITEYAKFIRDAKTIFANGPAGVFEQEGFSIGTEDILNTIAS---SNGYS 355 Query: 350 VVGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASIADKKKITRK 403 ++GGG AAA N+ GL +H+S+GGGAS+ L G++LP + + + K RK Sbjct: 356 IIGGGHLAAAANQMGLSSGITHISSGGGASINLLAGEKLPVVEILTEVKMKGRK 409 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 603 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 409 Length adjustment: 35 Effective length of query: 619 Effective length of database: 374 Effective search space: 231506 Effective search space used: 231506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory