GapMind for catabolism of small carbon sources

 

Protein WP_036261980.1 in Methylocapsa aurea KYG

Annotation: NCBI__GCF_000746085.1:WP_036261980.1

Length: 357 amino acids

Source: GCF_000746085.1 in NCBI

Candidate for 73 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 86% 231.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 86% 231.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 41% 85% 224.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-glucosamine (chitosamine) catabolism SM_b21216 med ABC transporter for D-Glucosamine, ATPase component (characterized) 41% 85% 216.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 74% 205.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 42% 74% 201.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 41% 85% 199.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-cellobiose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-galactose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-glucose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
lactose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-mannose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
sucrose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
trehalose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 75% 198.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 77% 195.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 77% 195.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-histidine catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 41% 83% 167.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-proline catabolism hutV med HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 41% 83% 167.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 39% 95% 220.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 38% 92% 219.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 92% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 92% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 92% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 92% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 92% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 38% 92% 212.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 35% 99% 212.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 37% 92% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 37% 92% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 39% 89% 210.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 39% 81% 209.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 44% 66% 209.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 40% 82% 209.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 95% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 97% 207.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 36% 94% 206.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 36% 90% 206.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 36% 88% 199.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 36% 94% 199.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 87% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 87% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 39% 87% 198.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 34% 98% 196.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 78% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 78% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 78% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 37% 78% 194.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 36% 95% 193.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 43% 68% 193.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 37% 87% 190.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 39% 61% 174.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 35% 89% 171 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 78% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 39% 85% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 39% 85% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 37% 98% 144.1 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-histidine catabolism hisP lo histidine transport ATP-binding protein hisP (characterized) 33% 96% 136.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 37% 93% 134.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 37% 93% 134.4 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 82% 126.3 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 36% 80% 125.9 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 37% 78% 125.2 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 36% 86% 114.8 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 34% 86% 110.5 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 91% 109 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 91% 109 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 91% 109 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 91% 109 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 91% 109 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 33% 91% 109 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 35% 84% 104 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 35% 84% 104 CysA aka B2422, component of Sulfate/thiosulfate porter 53% 286.2

Sequence Analysis Tools

View WP_036261980.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MQIRAVDIFKNFTGSSARPALDGVSLDVGSGELVALLGPSGSGKTTLLRIIAGLDFPDRG
SVYFGDEDASKKTVQERRVGFVFQNYALFKHLTVAENIAFGLEVRDRQTRPPKAEIRRRA
LELLDLVQLTGLEKRRPAQLSGGQRQRVALARALAGEPRGLLLDEPFGALDAKVRRDLRS
WLREIHLRTGHTTTFVTHDQDEALELADRVAVLNHGHIEQVGSPDEIYDHPATPFVHGFI
GEASALTVDLRAGNLFIGNHQLPLPGRSGRTGRGRLFVRPQDIVIGEGDANGIEAEIVAV
RRAGATRRAEIVIPADAGRVEIDAPAAVNFRPGERIPIRFLRGTFFLDGEGAASSLC

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory