Align lactaldehyde dehydrogenase (EC 1.2.1.22); D-glyceraldehyde dehydrogenase (NADP+) (EC 1.2.1.89) (characterized)
to candidate WP_036260778.1 DL86_RS09925 aldehyde dehydrogenase family protein
Query= BRENDA::P25553 (479 letters) >NCBI__GCF_000746085.1:WP_036260778.1 Length = 500 Score = 184 bits (466), Expect = 8e-51 Identities = 139/454 (30%), Positives = 211/454 (46%), Gaps = 14/454 (3%) Query: 29 PATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIERASWLRKISAGIRERASEISA 88 P + + R + D AI A A W ++P R +R +R ++ Sbjct: 26 PIDGSELGRAGEYSPPDVSAAIGRAHEAFLRWRSVPGPRRGQLIRGFGDVLRAHKEDLGL 85 Query: 89 LIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQSDRPGENILLFKRALGVTTG 148 L+ E GKI + EV D DY +R+ G I ++RPG + LGV Sbjct: 86 LVTCETGKIIEEGLGEVQEMIDICDYAVGLSRQLYGLTIAAERPGHAMRETWHPLGVVGI 145 Query: 149 ILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAFAKIVDEIG-----LPRGVFN 203 I +NFP + A AL+ G+ V KPSE TP A+A + D+ +P + Sbjct: 146 ITAFNFPVAVWAWNAVIALVCGDACVWKPSEKTPLCALAAQALFDKAADALDFVPPNLSQ 205 Query: 204 LVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKVCLELGGKAPAIVMDD 263 LV G G+ G+ L G+P+V +VS TGS G +I AK + LELGG IV Sbjct: 206 LVTG-GQRTGEALVGDPRVPLVSATGSTRMGREIAPQLAKRFARCILELGGNNAMIVAPS 264 Query: 264 ADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNRLGEAMQAVQFGNPAERNDI 323 ADL LA +AIV + V +GQ C R+ V + + RL A G+P +R + Sbjct: 265 ADLSLATRAIVFAAVGTAGQRCTSLRRLIVHDSLRPALIERLKLAYGQATIGDPRDRRHL 324 Query: 324 AMGPLINAAALERVEQKVARAVEEGARVAFGGKAV---EGKGYYYPPTLLLDVRQEMSIM 380 +GPLI+ AA + +++ + A G RV GG+ + YY L+++ + I+ Sbjct: 325 -IGPLIDKAAFDSMQRALKEAAAAGGRV-HGGERILIERWPDAYYVRPALVEMPDQAPIV 382 Query: 381 HEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMK--AIKGLKFGETYIN 438 H ETF P+L V+ + ++AI + N GL SSI+T +L A + + G G +N Sbjct: 383 HRETFAPILYVLGYRDWDEAIRLHNGVPQGLASSIFTTDLREAERFLSASGSDCGIANVN 442 Query: 439 -RENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQ 471 + + G G ++SG G G Y++ Sbjct: 443 IGPSGAEIGGAFGGEKESGGGREAGSDSWKAYMR 476 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 479 Length of database: 500 Length adjustment: 34 Effective length of query: 445 Effective length of database: 466 Effective search space: 207370 Effective search space used: 207370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory