Align Succinate-semialdehyde dehydrogenase [NADP(+)]; SSDH; EC 1.2.1.79 (characterized)
to candidate WP_036260778.1 DL86_RS09925 aldehyde dehydrogenase family protein
Query= SwissProt::P94428 (462 letters) >NCBI__GCF_000746085.1:WP_036260778.1 Length = 500 Score = 216 bits (550), Expect = 1e-60 Identities = 140/452 (30%), Positives = 220/452 (48%), Gaps = 10/452 (2%) Query: 10 PATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTSANERTSLLKKWYELIVEHKEELAD 69 P G E+ + S +V AI R+H+AF W R L++ + +++ HKE+L Sbjct: 26 PIDGSELGRAGEYSPPDVSAAIGRAHEAFLRWRSVPGPRRGQLIRGFGDVLRAHKEDLGL 85 Query: 70 LITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVYGRTVPAPTTGKRIVVTRQPVGPVAA 129 L+T E GK +E +GEV ++ ++++YG T+ A G + T P+G V Sbjct: 86 LVTCETGKIIEEGLGEVQEMIDICDYAVGLSRQLYGLTIAAERPGHAMRETWHPLGVVGI 145 Query: 130 ITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTPLSAYELARLAYEAG-----IPKDVLQ 184 IT +NFP A+ A AL G + KP+ TPL A L +A +P ++ Q Sbjct: 146 ITAFNFPVAVWAWNAVIALVCGDACVWKPSEKTPLCALAAQALFDKAADALDFVPPNLSQ 205 Query: 185 VVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNSADTVKHVSMELGGHAPLIVDED 244 +V G G+ G P++ ++ TGST +G+ + A +ELGG+ +IV Sbjct: 206 LVTG-GQRTGEALVGDPRVPLVSATGSTRMGREIAPQLAKRFARCILELGGNNAMIVAPS 264 Query: 245 ADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDEFAAKLSEQVSKLKVGNGLEEGVN 304 AD+ LA + + AGQ C RLIVH+S++ +L + +G+ + Sbjct: 265 ADLSLATRAIVFAAVGTAGQRCTSLRRLIVHDSLRPALIERLKLAYGQATIGDPRDRRHL 324 Query: 305 VGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRNDDKGCYFVNPTVLTDVDTSMNIMH 364 +GP+I+K F+ + + +A G +V G Y+V P L ++ I+H Sbjct: 325 IGPLIDKAAFDSMQRALKEAAAAGGRVHGGERILIERWPDAYYVRP-ALVEMPDQAPIVH 383 Query: 365 EETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFFTENYRRG--IYISENLEYGIIGWND 422 ETF P+ ++ + D DEAI+L N P GLA+ FT + R + + GI N Sbjct: 384 RETFAPILYVLGYRDWDEAIRLHNGVPQGLASSIFTTDLREAERFLSASGSDCGIANVNI 443 Query: 423 GGPSA-VQAPFGGMKESGIGREGGSEGIEPYL 453 G A + FGG KESG GRE GS+ + Y+ Sbjct: 444 GPSGAEIGGAFGGEKESGGGREAGSDSWKAYM 475 Lambda K H 0.314 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 500 Length adjustment: 34 Effective length of query: 428 Effective length of database: 466 Effective search space: 199448 Effective search space used: 199448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory