Align AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_036260776.1 DL86_RS09915 ABC transporter
Query= TCDB::Q52815 (257 letters) >NCBI__GCF_000746085.1:WP_036260776.1 Length = 322 Score = 132 bits (332), Expect = 9e-36 Identities = 84/242 (34%), Positives = 134/242 (55%), Gaps = 15/242 (6%) Query: 18 VEIVNMNKWYGDFHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCINRLEEHQKGKIVVD 77 +E+ ++K +G + +++L++ G V+ GPSG GKST++R IN + +GKI + Sbjct: 2 IELREVSKSFGGALAVDNLSLRIEGGAFFVLIGPSGCGKSTVLRMINAMISCDRGKIEIG 61 Query: 78 GTELTNDLKKIDEV--RREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKQAEE---- 131 G D+ K+D V RR +G V Q LFPH TI +N P + + AE Sbjct: 62 G----QDIAKLDPVTLRRGIGYVIQSGGLFPHWTIKDNIAAVPRLLGWSDARCAERLDEI 117 Query: 132 VAMHFLKRVKIPEQANKYPGQLSGGQQQRVAIARSLCMNPKIMLFDEPTSALDPEMIKEV 191 VAM + +P +YP QLSGGQQQR+ +AR+L +P ++L DEP +ALDP ++ Sbjct: 118 VAMLRIDPALLP----RYPRQLSGGQQQRIGVARALAADPDVILMDEPFAALDPVSRADL 173 Query: 192 LDTMVGL-AEEGMTMLCVTHEMGFARQVANRVIFMDQGQIVEQNEPAAFFDNPQHERTKL 250 + + L A+ T++ VTH+M A ++A + M++G +V+ PA P + + Sbjct: 174 QEELRRLHAQSCKTIVFVTHDMDEALRLATHMAVMNKGALVQTGAPAEIMLRPADQFVRA 233 Query: 251 FL 252 FL Sbjct: 234 FL 235 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 322 Length adjustment: 26 Effective length of query: 231 Effective length of database: 296 Effective search space: 68376 Effective search space used: 68376 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory