Align AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate WP_036263543.1 DL86_RS16195 ABC transporter ATP-binding protein
Query= TCDB::Q52815 (257 letters) >NCBI__GCF_000746085.1:WP_036263543.1 Length = 237 Score = 131 bits (330), Expect = 1e-35 Identities = 86/230 (37%), Positives = 130/230 (56%), Gaps = 11/230 (4%) Query: 15 EVAVEIVNMNKWYGD----FHVLRDINLKVMRGERIVIAGPSGSGKSTMIRCINRLEEHQ 70 E AVE+ N++ G H+L+ ++L + RGE + + GPSGSGKST++ + LE Sbjct: 6 EPAVELENIHLSLGRGAARVHILKGLSLTIGRGETVGLVGPSGSGKSTLLMIMAGLERPD 65 Query: 71 KGKIVVDGTELTN-DLKKIDEVR-REVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKQ 128 G + VDG L D ++ R +G+VFQ F+L P +T LEN + + Sbjct: 66 SGVVKVDGALLNGFDEDQLARFRGAAIGIVFQSFHLIPTMTALENVAIP---LELAGAAS 122 Query: 129 AEEVAMHFLKRVKIPEQANKYPGQLSGGQQQRVAIARSLCMNPKIMLFDEPTSALDPEMI 188 A + A LK V + ++ YP QLSGG+QQRVA+AR+L NP I++ DEPT LD Sbjct: 123 AFDRAAAELKAVGLEDRLAHYPAQLSGGEQQRVALARALAPNPAILVADEPTGNLDEATG 182 Query: 189 KEVLDTMVGL-AEEGMTMLCVTHEMGFARQVANRVIFMDQGQIVEQNEPA 237 + ++D M L + G T++ VTH++ A + +R I + G+I E+ E A Sbjct: 183 QSIIDLMFALKRDRGSTLILVTHDLALAAR-CDRSIRLRSGRIEEEPEKA 231 Lambda K H 0.321 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 237 Length adjustment: 24 Effective length of query: 233 Effective length of database: 213 Effective search space: 49629 Effective search space used: 49629 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory