Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_036260489.1 DL86_RS08980 amino acid ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_000746085.1:WP_036260489.1 Length = 253 Score = 265 bits (676), Expect = 8e-76 Identities = 135/241 (56%), Positives = 180/241 (74%), Gaps = 2/241 (0%) Query: 2 IELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVN 61 IE+ VNK++G HVL++INLSV GE++VI GPSGSGKST IRC+N LE SG+++V Sbjct: 14 IEIIAVNKWFGAFHVLRDINLSVAPGERIVICGPSGSGKSTLIRCINRLEAHQSGKIIVE 73 Query: 62 NLVLNHK-NKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYL 120 L KI+ R+ MVFQHFNL+PH+T+L+N TLAP++++K ++ EAE A YL Sbjct: 74 GTELTGDLRKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIEVRKMARAEAEAIALHYL 133 Query: 121 KVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKE 180 V + ++A+ YP LSGGQQQRVAIAR+LC +LFDEPTS+LDPE ++EVL+ M E Sbjct: 134 GKVHIPEQAHKYPGQLSGGQQQRVAIARALCMNPKIMLFDEPTSSLDPEMVKEVLETMAE 193 Query: 181 ISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGKIL 240 ++ + TM+ VTHEMGFA++VADR+IFM+ GAIVE N P FFS+P+ ER + FLG+IL Sbjct: 194 LARE-GMTMLCVTHEMGFARQVADRVIFMDAGAIVEINGPEAFFSDPQHERTKAFLGQIL 252 Query: 241 K 241 K Sbjct: 253 K 253 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 253 Length adjustment: 24 Effective length of query: 218 Effective length of database: 229 Effective search space: 49922 Effective search space used: 49922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory