Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_036259611.1 DL86_RS06380 3-oxoacyl-[acyl-carrier-protein] reductase
Query= reanno::Burk376:H281DRAFT_00644 (263 letters) >NCBI__GCF_000746085.1:WP_036259611.1 Length = 245 Score = 109 bits (272), Expect = 6e-29 Identities = 77/250 (30%), Positives = 124/250 (49%), Gaps = 14/250 (5%) Query: 12 GLRVFVSAGAAGIGLAIAEAFIEAQAEVYICDVNQAAIDEATSRFP-KLHAGIADVSKQA 70 G V+ + G+G AIA A V + +AA+DE + +H D++ +A Sbjct: 6 GKTALVTGASGGLGQAIARGLHRRGAIVGLSGTRRAALDELAAELATNVHILPCDLADKA 65 Query: 71 QVDQIIDDARRKLGGLDVLVNNAGIAGPTGAVEELDPAQWESTVSTNLNSQFYFLRKAVP 130 V+ +I A +GG+D+LVNNAG+ + D +WES +S NL + F R + Sbjct: 66 AVEALIPAAEAAMGGVDILVNNAGVTKDNLFMRMKDE-EWESVLSVNLTAVFRLSRACLK 124 Query: 131 VLKETSDCASIIAMSSVAGRLGYPFRTPYASTKWAIVGLVKSLAAELGPSNVRVNAILPG 190 + II +SSV G G + YA++K ++G+ KSLAAE+ +V VN + PG Sbjct: 125 GMLRKR-YGRIIGISSVVGVTGNAGQGNYAASKAGMIGMFKSLAAEVASRSVTVNCVAPG 183 Query: 191 VVEGERMDRVISARADALGIPFNAMREEYLKKISLRRMVTVDDIAAMALFLASPAGSNVT 250 +E S D L + L ++ + R+ T ++AA ++LAS + VT Sbjct: 184 FIE--------SPMTDVLN---EKQKSGILAQVPMGRLGTGAEVAAAVVYLASSEAAYVT 232 Query: 251 GQAISVDGNV 260 GQ + V+G + Sbjct: 233 GQTLHVNGGM 242 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 245 Length adjustment: 24 Effective length of query: 239 Effective length of database: 221 Effective search space: 52819 Effective search space used: 52819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory