Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_036259611.1 DL86_RS06380 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000746085.1:WP_036259611.1 Length = 245 Score = 132 bits (332), Expect = 7e-36 Identities = 85/254 (33%), Positives = 134/254 (52%), Gaps = 15/254 (5%) Query: 2 DLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSSTEVQGYALD 61 DL K ++TG +GGLG A+A + GA + L + L+ A+L +T V D Sbjct: 3 DLSGKTALVTGASGGLGQAIARGLHRRGAIVGLSGTRRAALDELAAEL--ATNVHILPCD 60 Query: 62 ITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVINVN 121 + D+ V A G +++LVNNAG+ +D + ++ KD ++++SV++VN Sbjct: 61 LADKAAVEALIPAAEAAMGGVDILVNNAGVTKDNLFMRMKD---------EEWESVLSVN 111 Query: 122 LTGTFLCGREAAAAMIESGQAGVIVNISSLAKA-GNVGQSNYAASKAGVAAMSVGWAKEL 180 LT F R M+ + G I+ ISS+ GN GQ NYAASKAG+ M A E+ Sbjct: 112 LTAVFRLSRACLKGMLRK-RYGRIIGISSVVGVTGNAGQGNYAASKAGMIGMFKSLAAEV 170 Query: 181 ARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIEND--Y 238 A ++ VAPG I + MT + + + VP+GRLG E+A+ V ++ ++ Y Sbjct: 171 ASRSVTVNCVAPGFIESPMTDVLNEKQKSGILAQVPMGRLGTGAEVAAAVVYLASSEAAY 230 Query: 239 VNGRVFEVDGGIRL 252 V G+ V+GG+ + Sbjct: 231 VTGQTLHVNGGMAM 244 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 245 Length adjustment: 24 Effective length of query: 228 Effective length of database: 221 Effective search space: 50388 Effective search space used: 50388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory