Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_034210119.1 N787_RS01085 NADP-dependent malic enzyme
Query= curated2:P39197 (318 letters) >NCBI__GCF_000747155.1:WP_034210119.1 Length = 764 Score = 142 bits (358), Expect = 3e-38 Identities = 105/335 (31%), Positives = 169/335 (50%), Gaps = 28/335 (8%) Query: 1 MKPLDRIHEAAKALDRHIILPEGEDPRVAEAARRLLAAGLARVTLMGGP-----EIPGAG 55 MKP + + A+A + ++ EGE+ V A + ++ GLAR L+G P I G Sbjct: 435 MKP---VFDRARADRKRVVYAEGEEETVLRAVQTVVDEGLARPILVGRPAVIERRIQRLG 491 Query: 56 R-------IDPAGGPDLAELADHW---HRMRAARGMT--AERALTEMRDPIRQAAMRVRL 103 +D D D+W H++ +G+T A +A+ RD + AA+ VR Sbjct: 492 LRLRIGVDVDVTNIDDDPRFNDYWQLYHQIMQRKGITPAAAKAIVRSRDVVI-AALMVRR 550 Query: 104 GQADGTVGGAVATTADTVRAALQIIGKAPGAGIVSSFFLMLSCGPGAPVRGGMIFADCGL 163 G+AD + G V ++ +I+G +S+ +L+ +G F D + Sbjct: 551 GEADALLCGLVGRFVRKLKYVREILGVESETRGLSALSAVLN------EKGVFFFTDTHV 604 Query: 164 VIQPDARELAAIALSAADSCRRILAEEPRVALLSFSTAGSAEHPSLGRIREALALIRAAA 223 + P A E+A + +A + + P+ AL+S S GS++ S ++R+ALA++R A Sbjct: 605 NVDPSAAEVAESLIQSAFRLK-LFGITPKAALVSHSNFGSSDSASSQKMRDALAILRERA 663 Query: 224 PGLEVDGEMQFDAALDEAIRARKAPESPLTGRPNVFVFPDLADGNIGYKIAERLAGLTAI 283 P LEV+GEM D AL+E R R P+S L+GR N+ F +L N Y + + I Sbjct: 664 PKLEVEGEMHADIALNEEARQRIFPQSQLSGRANLLAFSNLDAANASYNLVRSVTDGVGI 723 Query: 284 GPILQGLAKPANDLSRACSVKDIVNATAITAMQTK 318 GPIL GLA A+ L+ + +V+ +VN TAI A+ + Sbjct: 724 GPILMGLASAAHVLTPSATVRRVVNMTAIAAVDAQ 758 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 764 Length adjustment: 34 Effective length of query: 284 Effective length of database: 730 Effective search space: 207320 Effective search space used: 207320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory