Align Periplasmic gluconolactonase, PpgL (characterized, see rationale)
to candidate WP_052752433.1 HA49_RS04380 lactonase family protein
Query= uniprot:Q9HWH7 (388 letters) >NCBI__GCF_000757425.2:WP_052752433.1 Length = 405 Score = 204 bits (520), Expect = 3e-57 Identities = 133/400 (33%), Positives = 214/400 (53%), Gaps = 31/400 (7%) Query: 4 LPTLCLLALAPLTGVAPQAQAAS---LYNLLVGTYT-EGSSEGIQ--------VYRFD-G 50 +P L ++ +P AQ A LVG++T + + E +Q +YR Sbjct: 18 IPLLLSTGISYAENSSPLAQPAHHLPTQTFLVGSWTGQATGEMVQKAIYPSQGIYRVRLN 77 Query: 51 ADGSVKGPLRVAHTSNPSYLTFAPDQRTLFVVNENGRGGKGDTVGRATSYRFDPISGRLQ 110 +DGS+ PL + ++PS++ F+ + + + NEN G T+ R G+L Sbjct: 78 SDGSLL-PLDMLKLASPSWIVFSHNNKFAYTTNENDAGS-------VTALRVGK-QGKLS 128 Query: 111 QISQVQTLADHPTYSSLSHDGRYLFVANYSVQP-EGSVAVLPVRADGSLAPVVQ----VE 165 I+Q +L PT+++++ D +YL ANYSV P + + P+R DG++ VQ ++ Sbjct: 129 TINQADSLGSQPTHATITLDDKYLIAANYSVAPGHAGITLFPLRTDGAIEDAVQHIPFID 188 Query: 166 SHQASKVHPRQVSGHVHSVVSSPDGQYLFAPDLGADKVFVYRYAPEQAERPLQAADPAFV 225 K RQ GH HSV +PDG+ LF DLGAD V + Y E+++ PL + Sbjct: 189 GSHVVK--DRQDGGHAHSVNMTPDGKMLFVADLGADTVHAFSYHGEKSQ-PLTPEPDFDL 245 Query: 226 PTPPGSGPRHLIFSADGRFAYLTLELSGQVMVFAHEGNGRLRQLQTHDLAPAGFQGKVGA 285 PG GPRH+ FS+DG+FAY++ E+S +V V+ E + +L ++Q DL + G Sbjct: 246 HFKPGEGPRHMTFSSDGKFAYISTEMSAKVHVYRIE-HDKLSEIQVADLTESKNPDDKGG 304 Query: 286 GALHLSADGRFLGVLNRGDDNQLVTFAVDPASGQLRFVERRSVEGTEPREFAFSPGGRFV 345 + S D +FL V NR NQ+V F DP +G+L R S G EPR FAF G+++ Sbjct: 305 AGILFSPDHKFLYVGNRRKVNQIVVFKADPVTGKLTLTRRFSSGGIEPRAFAFDKTGQYM 364 Query: 346 LVANQNSDQLRVFARDPQSGQVGKTLQSVEVGSPSDLRFV 385 +VAN S+ + R+ ++G + T ++++G+P+D++FV Sbjct: 365 IVANVFSNNVVELRRNTENGDLTPTAVTLQIGTPTDIKFV 404 Lambda K H 0.318 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 48 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 405 Length adjustment: 31 Effective length of query: 357 Effective length of database: 374 Effective search space: 133518 Effective search space used: 133518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory