Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate WP_038021268.1 HA49_RS06300 (2Fe-2S)-binding protein
Query= metacyc::MONOMER-20832 (151 letters) >NCBI__GCF_000757425.2:WP_038021268.1 Length = 179 Score = 124 bits (312), Expect = 6e-34 Identities = 61/135 (45%), Positives = 85/135 (62%), Gaps = 1/135 (0%) Query: 2 ELRINQKAYQVDADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRSCVTPV 61 +L++N + V A D+ LL V+R++L L G KYGCGL +CGAC+VL+ G RSCV P Sbjct: 21 DLQVNGETRNVSAYKDSSLLLVLRNELSLNGPKYGCGLGECGACTVLIGGIAARSCVIPA 80 Query: 62 AGVVGREITTIEAIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSKAQ 121 GV REITT+E + + V +++ Q AQCG+C +G +M +LL P P + Q Sbjct: 81 WGVRQREITTLEGLGNRQRLHPVQQAFIDKQAAQCGFCLNGMIMTCASLLNDNPNPDEQQ 140 Query: 122 IDAAMI-NLCRCGTY 135 I A+ NLCRCGT+ Sbjct: 141 IRQALSGNLCRCGTH 155 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 86 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 151 Length of database: 179 Length adjustment: 18 Effective length of query: 133 Effective length of database: 161 Effective search space: 21413 Effective search space used: 21413 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory