Align The fructose-specific PTS Enzyme IIABC FruA (characterized)
to candidate WP_038021225.1 HA49_RS06185 PTS fructose transporter subunit EIIC
Query= TCDB::Q0S1N2 (700 letters) >NCBI__GCF_000757425.2:WP_038021225.1 Length = 360 Score = 244 bits (622), Expect = 7e-69 Identities = 140/341 (41%), Positives = 202/341 (59%), Gaps = 22/341 (6%) Query: 336 RQVLLTGVSYMIPFVAAGGLLIALGFLLGGYEISGPAEDIVLSNSLGQLPEGGLATYLGA 395 RQ L+TGVSYMIPFV +GG+L+A+ + G G +P+ A L Sbjct: 12 RQHLMTGVSYMIPFVVSGGILLAVAVMFYGK---------------GAVPDAESAANLKK 56 Query: 396 VLFQLGSLAFSFLVPALAGYIAFAIADRPGLAPGFTAGAVAVFVGAGFIGGLVGGLIAGV 455 LF +G + +VP LA YI ++I++R LAP A V GAGF G L+ G+I G+ Sbjct: 57 -LFDIGVAGLTLMVPFLAAYIGYSISERSALAPCAIAAWVGNSFGAGFFGALIAGIIGGI 115 Query: 456 VALWISRIPVPQWLRGLMPVVIIPLFATLIVGALMFLVLGRPLASITSGLTNWLNGLSGS 515 V ++ +IPV + LR +MP+ +IP+ TLI +M LG P+ +T LT WL G+ Sbjct: 116 VVYYLKKIPVHKVLRSVMPIFVIPVIGTLITAGIMMWGLGEPVGMLTKSLTVWLQGMQQG 175 Query: 516 SVIFLGIILGLMMCFDLGGPVNKAAYAFAVAGLNVNDPASLRIMAAVMAAGMVPPLAMAL 575 SV+ L +I+GLM+ FD+GGPVNK AYAF + + ++A + +PPL + L Sbjct: 176 SVVILAVIMGLMLAFDMGGPVNKVAYAFMLICV---AQGVYHVVAIAAVSICIPPLGLGL 232 Query: 576 ASTVLRPSLFSEAERENGKAAWLLGSAFISEGAIPFAAADPLRVIPSMMAGGAVTGALIM 635 A+ + R + FS E+E GKAA ++G ++EGAIPFAA+DPLRVIPS+M G+V+GA++ Sbjct: 233 ATLIGRRN-FSAEEQEAGKAALVMGCVGVTEGAIPFAASDPLRVIPSIML-GSVSGAVVA 290 Query: 636 AF-DVTLSAPHGGIFVFFAIGNLLWFLVALAAGVVVAALCV 675 A A GG+ V + +L+A+ G+VV ALCV Sbjct: 291 ALTGAECYAGWGGLIVLPVVSGKFGYLLAVVTGMVVTALCV 331 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 609 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 700 Length of database: 360 Length adjustment: 34 Effective length of query: 666 Effective length of database: 326 Effective search space: 217116 Effective search space used: 217116 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory