GapMind for catabolism of small carbon sources

 

Alignments for a candidate for fruII-B in Tatumella morbirosei LMG 23360

Align PTS system, fructose-specific, IIB subunnit, component of Fructose Enzyme II complex (IIAFru - IIBFru - IICFru) (based on homology) (characterized)
to candidate WP_038021227.1 HA49_RS06190 PTS fructose-like transporter subunit IIB

Query= TCDB::D2RXA4
         (150 letters)



>NCBI__GCF_000757425.2:WP_038021227.1
          Length = 104

 Score = 92.0 bits (227), Expect = 2e-24
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 2  KFVAVTSCPTGIAHSQMAAENLEQTATDRGHEIDVEVQGAMGQENELSSDAIAEADAVII 61
          K +AVT+CP+G+AH+ MAAE LE  A  RG ++ VE QG++GQEN L+ + I+EAD VI+
Sbjct: 3  KIIAVTACPSGVAHTYMAAEALETAAKSRGWQVKVETQGSLGQENTLTENDISEADLVIL 62

Query: 62 AADTSV-NQDRFEGKPVVTAPVKDAVNDVEDLLER 95
            D  + N++RF GK +V   + DAV   + ++ +
Sbjct: 63 TKDIGIQNEERFSGKTIVRVNISDAVKRADAIMTK 97


Lambda     K      H
   0.307    0.122    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 37
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 150
Length of database: 104
Length adjustment: 14
Effective length of query: 136
Effective length of database: 90
Effective search space:    12240
Effective search space used:    12240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)
S2: 41 (20.4 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory