Align NADH-dependent aldehyde reductase (EC 1.1.1.77; EC 1.1.1.244; EC 1.1.1.1) (characterized)
to candidate WP_038022371.1 HA49_RS09340 SDR family oxidoreductase
Query= metacyc::G3O-32155-MONOMER (298 letters) >NCBI__GCF_000757425.2:WP_038022371.1 Length = 303 Score = 174 bits (441), Expect = 2e-48 Identities = 102/292 (34%), Positives = 162/292 (55%), Gaps = 4/292 (1%) Query: 1 MKVFITGASGFIGSAVLSELISSGHEVVGLARSDEAAAKIKSIDPAAKILRGDLKDLEIL 60 M+VF+TGA+GFIGS ++ EL +GH+V+GLAR+ EA ++ A +G L+ E L Sbjct: 1 MRVFLTGATGFIGSRIIGELTEAGHQVIGLARTAEAEQYLQQKGVQAH--KGSLEHPETL 58 Query: 61 KKGATESDGVIHLGFVHDFKNFEQCCEIDRQATVAMLESLKGSNKPFLYTNGTLSLRPNK 120 GA+ +D VIH F H+F+ F + C+ +R+A A+ L+GS++P + T+G + Sbjct: 59 TAGASLADAVIHCAFDHNFEKFAENCQKEREAIKALGAGLQGSDRPLIITSGIGTGDAGD 118 Query: 121 VANEQDGI-DEDSKILRAVTEQVALSYKDKGVSARIVRLPFSVHGKGDKAFVPILMNIAK 179 ++ + + D R V+E +GV RIVRLP VH + + Sbjct: 119 GLPARESVFNSDHPNPRIVSELEGQKLLSQGVDVRIVRLP-QVHDTTRQGLLSPYAACCI 177 Query: 180 AAGKSGYVGQGTNAWAAVHRLDTAPLFRLVLEKGKTGQVYHCVGEQGIPFKDIARVIGEI 239 GK G+N W AVH D A L+ LVL+ G+ GQ Y+ V E+G+ I + + + Sbjct: 178 RQGKVACANDGSNRWPAVHVSDAARLYALVLDHGQKGQRYNAVAEEGVTSDLITQALSKG 237 Query: 240 LNVPVASIPVDDAESHFGFLTCFVTRDGPVSSEGTRKELGWQPQQIGLLEDI 291 LN+P I D+ ++ FG+++ F +D P S T+++LGW P+ L+ED+ Sbjct: 238 LNLPRVFISGDELQAFFGWMSMFADKDMPASGAWTQQQLGWHPRGPVLIEDL 289 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 303 Length adjustment: 27 Effective length of query: 271 Effective length of database: 276 Effective search space: 74796 Effective search space used: 74796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory