Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_038021929.1 HA49_RS08120 2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000757425.2:WP_038021929.1 Length = 313 Score = 174 bits (442), Expect = 2e-48 Identities = 112/292 (38%), Positives = 159/292 (54%), Gaps = 18/292 (6%) Query: 17 YLQQHAQVVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQF 76 Y Q + +Q + Q + VA+ G S + M+ LK ++ VG+D Sbjct: 28 YTQSSPEEIQAISEQTEIIVAS--------GEST-VNAEMISRFPNLKLIAVFGVGYDGI 78 Query: 77 DVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFG 136 DVA + I + NTPD+LT+ AD F+L+L ++RR+ +++ GHW P Sbjct: 79 DVATAISKNIQVTNTPDILTDDVADLGFALLLNASRRINAAQRFIEQGHWASGSFP--LA 136 Query: 137 VDVQGKTLGIVGLGRIGGAVARRAALGFNMKVL-YTNRSANPQAEEAYGARRVELAELLA 195 V GK LGIVG GRIG A+A+RA GF+M V ++ + Q + YG +L EL Sbjct: 137 SKVTGKRLGIVGYGRIGQAIAKRAR-GFSMSVACFSRHPVSEQDVKWYG----DLTELAH 191 Query: 196 TADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAG 255 +D + + V PET+ LI L ++ ILIN SRG+ VDE AL++A+ +G I GAG Sbjct: 192 QSDILVVCVSANPETRGLINKQVLTALGPQGILINISRGSVVDEVALVDAITHGDIGGAG 251 Query: 256 LDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 LDVF EP ++ LL VV PHI S THETR MA+ +N+ A L+G Sbjct: 252 LDVFAAEPSVPEA-LLNRPEVVLTPHIASGTHETRADMAKLVTDNITAFLNG 302 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 313 Length adjustment: 27 Effective length of query: 294 Effective length of database: 286 Effective search space: 84084 Effective search space used: 84084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory