Align PTND aka MANZ aka PTSM aka GPTB aka B1819, component of The mannose (glucose, 2-deoxyglucose, glucosamine, N-acetylglucosamine, N-acetylmannosamine, mannosamine and fructose) PTS porter/group translocator, ManXYZ (Rephaeli and Saier 1980; Plumbridge 2015). Catalyzes xylose facilitated diffusion in lactobacilli. The order of D-sugar substrate affinities is: glucose > mannose > 2-deoxyglucose > N-acetylglucosamine > glucosamine > N-acetylmannosamine > mannosamine > fructose (characterized)
to candidate WP_156994653.1 HA49_RS13135 PTS mannose transporter subunit IID
Query= TCDB::P69805 (286 letters) >NCBI__GCF_000757425.2:WP_156994653.1 Length = 285 Score = 517 bits (1332), Expect = e-151 Identities = 255/286 (89%), Positives = 269/286 (94%), Gaps = 1/286 (0%) Query: 1 MSEMVDTTQTTTEKKLTQSDIRGVFLRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPEN 60 M EMVDT + T EKKLT DIRGVF+RSNLFQGSWNFERMQALGFCFSMVPAIRRLYPEN Sbjct: 1 MREMVDTARPT-EKKLTPGDIRGVFIRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPEN 59 Query: 61 NEARKQAIRRHLEFFNTQPFVAAPILGVTLALEEQRANGAEIDDGAINGIKVGLMGPLAG 120 N+AR+QAI+RHLEFFNT P+VAAP+LGVTLA+EE+RANGAEIDD AINGIKVGLMGPLAG Sbjct: 60 NDARRQAIKRHLEFFNTHPYVAAPVLGVTLAMEEKRANGAEIDDAAINGIKVGLMGPLAG 119 Query: 121 VGDPIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNLVRLATRYYGVAYGYSKGIDIV 180 VGDPI+WGTVRPVFAALGAGIAMSGSLLGPLLFF+LFN+VRL TRYYGVAYGY KGIDIV Sbjct: 120 VGDPIYWGTVRPVFAALGAGIAMSGSLLGPLLFFVLFNIVRLLTRYYGVAYGYRKGIDIV 179 Query: 181 KDMGGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSRITDQTGKEHVTTVQTILDQ 240 KDMGGGFLQK+TEGASILGLFVMGALVNKWTHVNIPLVVS I DQ G EHVTTVQTILDQ Sbjct: 180 KDMGGGFLQKMTEGASILGLFVMGALVNKWTHVNIPLVVSTIRDQNGAEHVTTVQTILDQ 239 Query: 241 LMPGLVPLLLTFACMWLLRKKVNPLWIIVGFFVIGIAGYACGLLGL 286 LMPGLVPLLLTFACMWLLRKKVN LWII+GFFVIGI GYA GLLGL Sbjct: 240 LMPGLVPLLLTFACMWLLRKKVNALWIIIGFFVIGIVGYAIGLLGL 285 Lambda K H 0.326 0.143 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 285 Length adjustment: 26 Effective length of query: 260 Effective length of database: 259 Effective search space: 67340 Effective search space used: 67340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory